SecReT6
Protein ID: 472323940
SecReT6 ID743
T6SS typei1
Gene symbol-
Locus tagH681_03820
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]824097..824825 [-]
Productserine/threonine phosphoprotein phosphatase Stp1
NoteStp1
UniProt IDM4WTZ9
KEGG IDpdr:H681_03820
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 7.10E-22, Aligned region: 19..227
PP2C [PF00481], Evalue: 4.60E-17, Aligned region: 30..210
SpoIIE [PF07228], Evalue: 6.60E-14, Aligned region: 36..242
Protein Sequence: 242 a.a.     [Download]
>gi|472323940|ref|YP_007656186.1| serine/threonine phosphoprotein phosphatase Stp1 [Pseudomonas denitrificans ATCC 13867]
MQVATRWRSQARTDAGKVRARNEDAFLDCPELGLWAVADGMGGHARGDRASRMIVDALARIPSDAEHDSR
EQQVRQQLHWLNRRFVMELTQAADQPPQVMGSTVVALLLQSHRATCVWAGDSRCYLWRDGRLYQLTRDHS
LQQQLMEEQGLSAEQARRHPSAHALTRAVGVGDKFALDTLELTVHPGDTFLLCSDGLYNGHSEQSLCAAL
GHSSIEHALEQLFSHALEGSARDNLTAVVIRR
 
Nucleotide Sequence: 729 bp     [Download]
>gi|472323176|ref|NC_020829.1|:c824825-824097 Pseudomonas denitrificans ATCC 13867, complete genome
ATGCAAGTCGCGACACGCTGGCGCAGCCAGGCGCGCACGGACGCGGGCAAGGTCCGTGCGCGCAACGAGG
ACGCCTTCCTCGACTGTCCGGAGCTCGGTCTCTGGGCAGTCGCCGACGGCATGGGCGGCCACGCCCGTGG
CGATCGCGCCAGCCGCATGATTGTCGATGCCCTTGCACGTATCCCGTCTGACGCGGAGCACGACAGCCGC
GAGCAGCAGGTCCGCCAGCAATTGCACTGGCTCAACCGGCGCTTCGTCATGGAGCTGACCCAAGCCGCCG
ACCAGCCACCGCAGGTCATGGGTAGCACCGTCGTGGCGCTGCTTCTGCAATCGCACCGCGCGACCTGCGT
CTGGGCCGGCGACAGCCGCTGCTACCTGTGGCGCGATGGCCGTCTGTACCAGCTCACCCGCGACCACTCG
CTGCAACAACAACTGATGGAAGAACAGGGGCTGAGCGCCGAGCAGGCCCGGCGCCACCCTTCGGCCCATG
CGCTCACCCGCGCAGTAGGCGTCGGCGACAAGTTTGCCCTCGACACCCTGGAACTGACCGTCCACCCCGG
CGATACCTTCCTGCTCTGCAGCGATGGCCTCTACAACGGCCACAGCGAGCAATCACTCTGCGCCGCGCTG
GGCCACAGCTCCATCGAGCACGCGCTGGAACAACTGTTCAGCCACGCCCTGGAAGGCTCGGCGCGAGACA
ACCTGACTGCCGTGGTGATACGCCGATGA
 Primer design