SecReT6
Protein ID: 472323941
SecReT6 ID743
T6SS typei1
Gene symbol-
Locus tagH681_03825
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]824825..828361 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDM4WVB0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.00E-76, Aligned region: 502..792
IcmF-related [PF06761], Evalue: 4.00E-76, Aligned region: 952..1018
ImcF-related_N [PF14331], Evalue: 3.10E-75, Aligned region: 196..455
DUF1215 [PF06744], Evalue: 4.70E-36, Aligned region: 913..1037
DUF4131 [PF13567], Evalue: 0.003, Aligned region: 16..93
DUF4131 [PF13567], Evalue: 0.003, Aligned region: 446..479
Protein Sequence: 1178 a.a.     [Download]
>gi|472323941|ref|YP_007656187.1| type VI secretion protein IcmF [Pseudomonas denitrificans ATCC 13867]
MKNFFKKAGAFLRRTWVWSLLLVLLLALLVWFAGPLLAVNEHKFWESASARLLSIAVLFLGWGLFMVFAS
WRAMRRKKAEEESEDGQERLRRQELISDEQQELRSRFQDALRILKTSSLYRGRGERWRNELPWYLMLGPQ
GSGKTSLLDFSGLEFPINKIERKLTRDTSGTRYCDWYFAEHGVLVDATGRYLSQGDAEVDASGWSTLLDL
LRKRRRARPLNGVVVNIPVDLLLAGDEQGLEALGRQIRARLQDVHRNLHIDLPIYLVLGKADKLLGFDEF
FDQLSREESDQVLGVSFRKEQNGTDAGVLRQEFEELLRRLNSQVILRMHQERNTQRRGRILDFPHQLAQI
GDRLSLLVEFAFTGNRYQRASQLRGFYLTSAPHLTQQMDADTAAIGANLGMASVKLPTLRQGRPRFIHHL
FSQVIFPESELAGLDKRESARIHWGQRAVYAASLALLAVFGLVWTNGFSANNGRLDQVRDLGQKLAREHA
ALTPQDDARATLKALDTSYAASQVFPSKGDVSFTERAGLYQGEDSTPTLTAAYQRELQAQLLPRVARTLE
GQIRANLNDRERLLGSLRAYLMLNLPERRDADFLKDWIGADWSVRYSGDAVVQNGLGTHFARLLEQPFVY
PLNEPLVAQARQVLRSESLASVVYRVLREQARSLPEYRFDQHLGPQGALFSGTDYIIPGFYTLRGYQQYF
VAQGAPMVREILRDNWVLGEGNSLSGQDLSRLMVELQQLYFRDYANLWSEAVNRVQLQPITEFDRGADEV
AGLTAANSPLLQLLVEVRENTRIPGIAESTEAAGDLASAAADAGGKIGKVGKVAAAAAEQAQDALAKSLP
DTARQAMQRRFEPLHRLLDDNGGPAADLAPVMQALNGLQLQLSSLARASQPEQVAFELARGRMGGQVDAL
ATLRSAAVRLPQPVSGWFNLLAEDSWTLVLGDAYRYLNQRYQAELYSFYFKAINQRYPFNARSNSDVAIA
DFREFFKAQGIADRFFDSYLKSFVSGDPGNYRLRSVDGHSLPMSRAFLDQMGYAQAIRRSFFADNPAEPQ
VQFKLEPYSIDSSLSRADFRFGDQQLEYRHGPIVPVAFRWPTDADDGRTSLVLEELGGRRVSLEKNTGPW
SLFRLFDQMQSEYLRGRDVLMLKADLGGLRANYLVLAQRSPNPFDLGNLRSFRLPVSL
 
Nucleotide Sequence: 3537 bp     [Download]
>gi|472323176|ref|NC_020829.1|:c828361-824825 Pseudomonas denitrificans ATCC 13867, complete genome
ATGAAGAACTTCTTCAAGAAAGCCGGCGCCTTCCTGCGCCGGACCTGGGTCTGGAGCCTGCTGCTGGTGC
TCCTGCTGGCGCTGCTGGTGTGGTTTGCCGGCCCGTTGCTGGCGGTGAACGAACACAAGTTCTGGGAGAG
TGCCAGCGCCCGCCTGCTGAGCATCGCTGTACTCTTCCTCGGCTGGGGCCTGTTCATGGTCTTCGCCAGT
TGGCGCGCCATGCGCCGCAAGAAGGCCGAGGAGGAAAGCGAGGACGGCCAGGAACGCCTGCGTCGCCAGG
AGCTGATCAGCGACGAGCAGCAGGAACTGCGCTCACGCTTCCAGGACGCCCTGCGCATCCTCAAGACCTC
CAGCCTGTATCGCGGGCGTGGCGAGCGCTGGCGCAACGAGCTGCCCTGGTACCTGATGCTCGGCCCGCAG
GGCAGCGGCAAGACCAGCCTGCTGGACTTCTCCGGGCTGGAGTTCCCGATCAACAAGATCGAGCGCAAGC
TGACCCGCGACACCAGCGGCACCCGTTACTGCGACTGGTACTTCGCCGAACACGGCGTGCTGGTCGACGC
CACCGGCCGCTACCTGAGCCAGGGCGACGCCGAAGTCGACGCCAGCGGCTGGAGCACCCTGCTCGACCTG
CTGCGCAAACGCCGCCGCGCCCGCCCGCTCAACGGCGTGGTGGTCAACATCCCGGTGGACCTGCTGCTGG
CCGGCGACGAACAGGGCCTGGAAGCCCTCGGCCGGCAGATCCGCGCGCGCCTGCAGGACGTGCACCGCAA
TCTGCATATCGACCTGCCCATCTACCTGGTGCTGGGCAAGGCCGACAAACTGCTGGGCTTCGACGAATTC
TTCGACCAGCTCTCCCGCGAGGAAAGCGACCAGGTGCTGGGCGTCAGCTTCCGCAAGGAGCAGAACGGCA
CCGACGCCGGCGTGCTGCGCCAGGAGTTCGAAGAACTGCTGCGCCGCCTGAACAGCCAGGTCATCCTGCG
CATGCACCAGGAGCGCAACACCCAGCGCCGTGGTCGCATCCTCGACTTCCCGCACCAGTTGGCGCAGATC
GGCGACCGCCTGAGCCTGCTGGTCGAGTTCGCCTTCACCGGCAACCGCTACCAGCGCGCCAGCCAGCTTC
GCGGCTTCTACCTCACCAGTGCACCGCACCTGACCCAGCAGATGGATGCGGACACTGCCGCCATCGGCGC
CAACCTGGGCATGGCCAGCGTCAAGCTGCCGACCCTGCGTCAGGGTCGCCCACGCTTCATCCATCACCTG
TTCAGCCAGGTGATCTTCCCCGAGTCCGAACTGGCCGGCCTGGACAAGCGCGAGAGCGCGCGCATCCACT
GGGGCCAGCGCGCGGTCTACGCTGCCTCGCTGGCGCTGCTGGCGGTATTCGGCCTGGTCTGGACCAATGG
CTTCTCGGCCAACAACGGCCGCCTGGACCAGGTCCGCGACCTCGGCCAGAAGCTCGCCCGCGAACATGCC
GCACTCACCCCGCAGGACGACGCTCGCGCAACCCTCAAGGCGCTCGATACCAGCTACGCCGCCAGCCAGG
TATTCCCGTCCAAGGGCGATGTTTCCTTCACTGAACGTGCCGGTCTCTACCAGGGCGAGGACAGCACCCC
GACCCTGACCGCGGCTTACCAGCGCGAACTGCAGGCACAATTGCTGCCGCGCGTGGCGCGGACCCTCGAA
GGCCAGATCCGCGCCAACCTGAATGACCGCGAGCGCCTGCTCGGCAGCCTGCGTGCCTATCTCATGCTGA
ACCTGCCCGAGCGCCGCGACGCTGACTTCCTCAAGGACTGGATCGGCGCCGACTGGTCCGTGCGCTACAG
CGGTGACGCGGTGGTGCAGAACGGCCTGGGTACGCACTTCGCCCGCCTGCTCGAACAACCCTTCGTCTAC
CCGCTGAACGAACCACTGGTAGCCCAGGCACGCCAGGTACTGCGCAGCGAGTCCCTGGCCAGCGTGGTCT
ACCGCGTCCTGCGCGAGCAGGCCCGCAGCCTGCCCGAATACCGCTTCGACCAGCACCTGGGACCGCAAGG
CGCACTGTTCTCCGGCACCGACTACATCATCCCCGGCTTCTACACCCTGCGCGGCTACCAGCAATACTTC
GTCGCCCAGGGCGCGCCGATGGTCCGCGAGATCCTGCGCGACAACTGGGTGCTGGGCGAAGGCAACAGCC
TCAGCGGCCAGGACCTCAGCCGCCTGATGGTGGAGCTGCAGCAACTGTACTTCCGTGACTACGCCAACCT
GTGGAGCGAAGCGGTCAACCGCGTCCAGCTGCAGCCGATCACCGAGTTCGACAGGGGGGCAGACGAAGTG
GCCGGCCTCACCGCCGCCAACTCGCCGCTGCTGCAACTGCTGGTGGAAGTCCGCGAGAACACCCGCATTC
CGGGCATCGCCGAAAGCACCGAGGCCGCCGGCGATCTCGCCAGTGCCGCTGCCGATGCCGGCGGCAAGAT
CGGCAAGGTGGGCAAGGTCGCGGCAGCCGCCGCCGAGCAGGCCCAGGACGCCCTCGCCAAGAGCCTTCCG
GACACCGCCCGGCAAGCCATGCAGCGCCGCTTCGAACCACTGCACCGCCTGCTCGACGACAACGGCGGCC
CGGCGGCCGACCTCGCCCCGGTGATGCAGGCACTCAACGGCCTGCAGCTGCAACTGAGCAGCCTGGCCCG
CGCCAGCCAGCCGGAACAGGTCGCCTTCGAACTGGCCCGTGGCCGCATGGGCGGCCAGGTCGATGCTCTG
GCCACCCTGCGCAGCGCGGCCGTGCGCCTGCCGCAACCGGTGAGCGGCTGGTTCAACCTGTTGGCCGAGG
ACAGCTGGACCCTGGTGCTGGGCGACGCCTACCGCTACCTCAACCAGCGCTACCAGGCCGAGCTGTACAG
CTTCTACTTCAAGGCCATCAATCAGCGCTATCCGTTCAACGCCAGGAGCAACAGCGACGTTGCCATCGCC
GACTTCCGCGAGTTCTTCAAGGCCCAGGGCATCGCCGACCGCTTCTTCGACAGCTATCTGAAATCGTTCG
TCAGTGGCGATCCGGGTAACTACCGTCTGCGCAGCGTCGACGGCCACAGCCTGCCGATGTCACGCGCCTT
CCTCGACCAGATGGGCTACGCCCAGGCGATTCGCCGCAGCTTCTTCGCCGACAACCCGGCCGAGCCGCAG
GTGCAGTTCAAGCTGGAGCCCTACTCCATCGACTCCAGCCTGAGCCGCGCCGACTTCCGCTTCGGCGACC
AGCAACTGGAGTACCGTCATGGCCCGATCGTGCCAGTCGCCTTCCGCTGGCCGACCGACGCCGACGACGG
ACGCACCAGCCTGGTCCTGGAAGAACTCGGCGGTCGCCGCGTCAGCCTGGAGAAGAATACCGGCCCCTGG
TCGCTGTTCCGCCTCTTCGACCAGATGCAGAGCGAGTACCTGCGCGGGCGTGACGTGCTGATGCTCAAGG
CCGATCTCGGCGGTCTTCGCGCCAACTACCTGGTGCTGGCCCAGCGTTCGCCGAACCCGTTCGACCTCGG
CAACCTGCGCAGTTTCCGGCTGCCGGTCTCGCTCTGA
 Primer design