SecReT6
Protein ID: 472323947
SecReT6 ID743
T6SS typei1
Gene symbol-
Locus tagH681_03855
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]832497..834005 [-]
ProductFis family transcriptional regulator
NoteSfa2
UniProt IDM4WRF2
KEGG IDpdr:H681_03855
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 1.90E-71, Aligned region: 195..362
Sigma54_activ_2 [PF14532], Evalue: 5.60E-25, Aligned region: 196..366
HTH_8 [PF02954], Evalue: 4.80E-13, Aligned region: 16..27
HTH_8 [PF02954], Evalue: 4.80E-13, Aligned region: 352..359
HTH_8 [PF02954], Evalue: 4.80E-13, Aligned region: 455..495
HTH_30 [PF13556], Evalue: 2.50E-06, Aligned region: 464..495
AAA_5 [PF07728], Evalue: 7.90E-06, Aligned region: 219..336
GAF_3 [PF13492], Evalue: 3.60E-05, Aligned region: 27..142
GAF_3 [PF13492], Evalue: 3.60E-05, Aligned region: 202..262
AAA [PF00004], Evalue: 0.003, Aligned region: 219..337
GAF_2 [PF13185], Evalue: 0.0055, Aligned region: 26..147
GAF_2 [PF13185], Evalue: 0.0055, Aligned region: 257..291
Protein Sequence: 502 a.a.     [Download]
>gi|472323947|ref|YP_007656193.1| Fis family transcriptional regulator [Pseudomonas denitrificans ATCC 13867]
MFLRIPQPLNYAETLLEQYANLARAADVDSLLGQFVGAASELADCELVQLYLLDAGHSALGLNAECLDGL
LQPREATSLPADYKDEQLLQYSLCQNRVLSLAELNDSLHDTSFLPASGKPWRALLCLPLLDSQQAVQGLL
LCASHATGDLVGFARSLGQLGTFVHAQLQLLLRLRRPQRDSQPAAPGPCTSGYGMIGESPAMRRTYQLIS
KVLHSPYTVLLTGETGTGKELVARAIHDCGARRTANFVVQNCSALPEHLLESELFGYRKGAFTGADRDRR
GLFDAADGGTLFLDEIGDMPLALQAKLLRVLQEGEIRPLGSNDTHRIDVRIVAATHRDLEAMVSTGAFRE
DLYYRLAQFPIELPPLRQRGEDILELARHFAGKACSFLQRDPCNWSAAALDRLAGYGFPGNVRELKGMVE
RAVLLCETGELLPSHFNLRDVPLESSGTSNLRERLEQVERSMLLECLRKNGGNRTLAARELGLPRRTLLY
RLERLNIHTNET
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|472323176|ref|NC_020829.1|:c834005-832497 Pseudomonas denitrificans ATCC 13867, complete genome
ATGTTCCTGCGCATTCCCCAGCCGTTGAACTACGCCGAGACGCTCCTCGAGCAGTACGCCAACCTTGCGC
GTGCCGCCGATGTCGATAGCCTGCTCGGCCAGTTCGTCGGTGCCGCCAGCGAACTGGCGGACTGCGAGCT
GGTCCAGCTCTACCTGCTGGATGCCGGCCACAGCGCGCTCGGGCTGAACGCCGAATGCCTCGATGGCCTG
CTGCAACCGCGCGAAGCCACCAGCCTGCCCGCCGACTACAAGGACGAGCAGCTGCTGCAGTACAGCCTGT
GCCAGAACCGTGTGCTGAGCCTGGCCGAACTCAACGACAGCCTGCACGACACCAGCTTCCTGCCGGCCAG
CGGCAAGCCCTGGCGCGCCCTGCTCTGCCTGCCGCTGCTCGACTCGCAACAGGCCGTCCAGGGCCTGCTG
CTCTGCGCCAGCCATGCCACCGGCGACCTCGTCGGCTTCGCCCGCTCCCTTGGCCAGCTCGGTACCTTCG
TCCACGCCCAACTGCAGTTGCTGCTTCGCCTGCGCCGCCCACAGCGCGATAGCCAACCCGCGGCACCAGG
CCCCTGCACCAGTGGCTACGGGATGATCGGCGAAAGCCCGGCGATGCGTCGCACCTACCAGTTGATCAGC
AAGGTGCTGCACAGCCCCTACACCGTCCTGCTCACCGGCGAGACTGGCACCGGCAAGGAACTGGTCGCCC
GAGCCATCCATGACTGCGGCGCACGCCGCACCGCCAACTTCGTGGTGCAGAACTGTTCCGCACTGCCCGA
GCACCTGCTGGAGAGCGAGCTGTTCGGCTACCGCAAGGGCGCCTTCACCGGCGCCGACCGCGACCGTCGC
GGCCTGTTCGATGCCGCCGACGGCGGCACCCTGTTCCTCGACGAAATCGGCGACATGCCCCTGGCCCTGC
AGGCCAAGCTGCTGCGTGTACTGCAGGAAGGCGAGATACGCCCGCTGGGCAGCAACGATACCCATCGCAT
CGACGTACGCATCGTCGCCGCGACCCACCGCGACCTGGAAGCAATGGTCAGCACCGGCGCCTTCCGCGAG
GACCTCTACTACCGCCTGGCGCAGTTCCCCATCGAACTGCCGCCGCTGCGCCAGCGTGGCGAGGACATCC
TCGAGCTGGCCCGCCACTTCGCGGGCAAGGCCTGCTCCTTCCTCCAGCGCGACCCTTGCAACTGGTCCGC
CGCCGCGCTCGATCGCCTGGCCGGCTATGGCTTCCCCGGCAACGTCCGAGAACTCAAGGGCATGGTCGAG
CGCGCGGTCCTGCTGTGCGAGACCGGCGAGCTGCTGCCCTCGCACTTCAACCTGCGCGACGTACCGCTGG
AAAGCAGCGGCACCTCGAACCTGCGTGAACGCCTGGAGCAGGTCGAGCGTTCGATGCTGCTCGAATGCCT
GCGCAAGAACGGCGGCAACCGCACCCTGGCCGCCCGCGAGCTGGGGCTGCCGCGCCGCACCCTGCTGTAC
CGCTTGGAGCGCCTGAACATCCACACCAACGAGACATGA
 Primer design