SecReT6
Protein ID: 472326133
SecReT6 ID744
T6SS typei4a
Gene symbol-
Locus tagH681_14855
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]3350777..3351835 [-]
Producthypothetical protein
NoteTssA
UniProt IDM4WYF1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.30E-19, Aligned region: 57..116
Protein Sequence: 352 a.a.     [Download]
>gi|472326133|ref|YP_007658379.1| hypothetical protein H681_14855 [Pseudomonas denitrificans ATCC 13867]
MISDQALQALLRPLPGDAPCGESLRYDPRMDRLRELRREDDMQLPTGVWQAEPKRADWVALAALAEELLV
EHSKDLTIAAYLGEAWIIMDGPSGLAAALGLLADLCDAYPEQLHPRAADSDQEWRAAPVAWLVRRYNELL
LTRVPLCADWPQTTLHAWQELQRRQVQRGDNKADKAAAESARQEQKRLDEAVRSGAVGGWSATLTALGLA
VEHLKRLDAWCDRQLGDAAPSLHLLTESIDTFVNVIQGCKIMAPQEFAPAASSDNHAEPASIAAVAPAAL
PAGGPPQSREEAYRQLTAIAEYLARTEPHSPVPYIIRRAVEWGAMPLSALMDELVHADPEARRVWVMLGV
LR
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|472323176|ref|NC_020829.1|:c3351835-3350777 Pseudomonas denitrificans ATCC 13867, complete genome
ATGATTTCCGACCAGGCGCTACAGGCGCTGTTGCGCCCCTTGCCGGGTGACGCGCCGTGCGGCGAATCGC
TGCGCTATGACCCGCGGATGGACCGCTTGCGCGAGCTGCGCCGCGAGGACGATATGCAGCTACCGACCGG
CGTCTGGCAGGCCGAGCCCAAGCGTGCCGATTGGGTGGCGCTGGCAGCGCTGGCCGAAGAGCTGCTGGTG
GAGCACAGCAAGGACCTGACCATTGCCGCCTACCTGGGCGAGGCCTGGATCATCATGGACGGACCGTCCG
GGCTTGCCGCCGCGCTCGGCTTGCTGGCCGATCTCTGCGATGCCTACCCCGAGCAATTGCATCCGCGGGC
CGCCGACAGCGATCAGGAGTGGCGCGCTGCACCGGTGGCGTGGCTGGTCCGTCGCTACAACGAACTGCTG
CTCACCCGGGTGCCGCTCTGCGCCGACTGGCCGCAGACTACCCTGCATGCCTGGCAGGAGTTGCAACGGC
GGCAAGTCCAGAGAGGCGACAACAAGGCTGACAAGGCTGCTGCGGAAAGCGCCCGGCAGGAACAGAAGCG
ACTGGATGAAGCCGTCCGCAGCGGTGCGGTGGGCGGTTGGTCCGCCACGCTGACGGCGCTGGGGCTGGCC
GTCGAACACCTCAAGCGGCTGGACGCCTGGTGCGATCGCCAGCTCGGCGATGCCGCGCCAAGCCTGCACC
TGCTCACCGAGTCCATCGATACCTTCGTCAATGTCATTCAGGGATGCAAGATCATGGCACCGCAAGAATT
TGCACCCGCCGCGTCATCGGACAACCACGCGGAGCCGGCTTCCATCGCTGCGGTGGCGCCGGCCGCGCTG
CCGGCCGGCGGTCCTCCGCAGAGTCGTGAGGAGGCCTACCGGCAGCTCACCGCCATTGCCGAGTACCTGG
CGCGCACCGAACCCCATAGCCCTGTGCCGTACATCATTCGCCGTGCCGTGGAGTGGGGCGCCATGCCCTT
GAGCGCGCTGATGGACGAACTCGTCCATGCCGACCCCGAGGCTCGTCGGGTCTGGGTCATGCTGGGAGTG
TTGCGCTGA
 Primer design