SecReT6
Protein ID: 472326134
SecReT6 ID744
T6SS typei4a
Gene symbol-
Locus tagH681_14860
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]3351832..3355656 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDM4XHQ7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.20E-38, Aligned region: 116..354
DUF1215 [PF06744], Evalue: 0.0081, Aligned region: 986..1044
Protein Sequence: 1274 a.a.     [Download]
>gi|472326134|ref|YP_007658380.1| type VI secretion protein IcmF [Pseudomonas denitrificans ATCC 13867]
MSSWLILALFLLLVAALAAGVFLWIRSKGGEAVRAFYLTVRQMEQDQDVADRYDVPWFLLLGDPLLGERL
AADWSLTPAGRPAWFGRWWADQDGAVLAVPQALFLPEEGTPSSLQPWRRLLGLLLRMRPRRPLDGVIWTV
SAERLLDPASLAQESVLLRRRFNDLLQRLGLSLPVYVVVTGLEELDGFTELRAALPADVRERPLGWASPL
LADAAWQGEHLERGFDQVLQALQAAILEAGVLKGQLSEELYRFPQTLESLRDGLRQRLEPVFQGNALGEA
PRLRGLYFSGAFRVVASDDEWALSAREGAPAQLLFTQQLWQSRLLAERGLAQAVPRLLRLRQRSQRLLGT
VAGVVGVCWLLGMLWVWHEDSREAQALGQRIQAMQHGSGEGSASATAPVDAARLRLQAYWALLQGAPRWH
YRSLVYPSSWFSGFDSQMDELLRDLTRREVLTPLQQTQAADLVRLRVIRSSERRANVQSDSPEQWPNFVA
ARELASGVLAFEQRNRWYNELRTGTSKNPLESLARLGEQTYGLTLEPGTLRNARYLQSVLGKGIPEAPAP
VDPGPRDGPLARNFDDLMGLWLDQFFLSDNFVRPAGFLRLHLNELKARQGNSLEELEETAAQIDALRNMV
ALTNAAWSHGNAQEIVPGYRALLDDVRQSYLLGPAAEATVTSQASKLQRTFHDQWIAAAGSRDNLLQLQP
GGTLALQEHVVALGSAIESLMRQDFAGTALRQQEQEIDPRRLGNLDAHALNAALAYYDSYRKYSEQEQAR
IPAEYRDALAGSAAAATASAMWSSLSQSVPSSGAAAQITFDVPLEPAQQVRQALESLQRNDLANALDIHL
TRGALADVDTVLKSIDALPLFRVRSELSGWDGSRNFGLQLYRSTDTQDLKRSLAQQFESMLTLSEEHAPA
LTWLRDRGNLGFADQDKVRRFANLSDELSKYKAQNPTSSPMLLDQLVTRDFVEMDAASCANILRTSALVP
GQGDVARFTRGLHSQAQQRCLELQQKGAAAAWSAIADYFNQYLANRFPFAYSLQAEDADPARVQHLVELL
DQNLARAQEGLKLSQSVDRTAATDFLQRLQLARAWMGPLFQRDKGGARGVDLDVRWRTDREAERGADQVI
AWTLYAADRSLSFPGGDGQRLHWNVGEPVKVLLRWAKDSPQRPDIDPQQASMAVADLEVGWEYSGPWALI
RMLRSHLILQRQPSADYTDFPLALRVPIRSPNSHEPEARMFLRVSLMTPDAKQPLSIQPLPVRAPRTPFS
GVGIATFAGTQELP
 
Nucleotide Sequence: 3825 bp     [Download]
>gi|472323176|ref|NC_020829.1|:c3355656-3351832 Pseudomonas denitrificans ATCC 13867, complete genome
GTGAGCAGCTGGCTGATACTGGCGCTGTTCCTGCTGCTGGTGGCGGCGCTGGCGGCGGGAGTCTTTCTCT
GGATTCGCAGCAAGGGTGGCGAGGCGGTTCGCGCCTTCTACCTGACGGTACGGCAGATGGAGCAGGACCA
GGACGTCGCCGATCGCTACGATGTGCCCTGGTTCCTCCTGCTGGGCGATCCCTTGCTGGGCGAACGCCTC
GCCGCCGACTGGAGCCTGACTCCGGCCGGCCGGCCGGCGTGGTTCGGTCGTTGGTGGGCCGATCAGGACG
GCGCCGTGCTGGCGGTGCCGCAGGCGTTGTTCCTGCCGGAAGAGGGTACGCCCTCGTCGCTGCAACCCTG
GCGACGGCTGCTCGGCCTGCTGTTGCGGATGCGTCCGCGCCGCCCCCTGGACGGGGTGATCTGGACCGTG
TCGGCGGAGCGCCTGCTGGACCCGGCCAGCCTGGCCCAGGAAAGTGTCCTGCTGCGTCGCCGCTTCAATG
ACCTGTTGCAACGGCTGGGATTGAGCCTGCCGGTCTACGTGGTGGTGACCGGGCTGGAGGAGCTCGACGG
TTTCACCGAGCTGCGTGCCGCACTGCCCGCTGACGTTCGCGAGCGGCCACTGGGCTGGGCTTCGCCCTTG
CTGGCGGACGCGGCCTGGCAGGGCGAGCATCTGGAGCGCGGCTTCGACCAGGTGCTGCAAGCGCTGCAGG
CGGCGATTCTCGAGGCAGGGGTGCTCAAGGGGCAGTTGAGCGAGGAGTTGTATCGCTTCCCACAGACGCT
GGAGAGCTTGCGCGATGGGCTGCGCCAACGCCTGGAGCCGGTCTTCCAGGGCAATGCGCTGGGCGAGGCG
CCGCGCCTGCGGGGCCTGTACTTCAGCGGCGCGTTCCGGGTGGTGGCCAGTGACGATGAGTGGGCGCTCT
CCGCTCGGGAAGGGGCTCCCGCACAATTGCTGTTCACCCAGCAGCTCTGGCAATCGCGTCTGCTGGCCGA
GCGCGGGCTGGCCCAGGCGGTGCCACGGCTGCTGCGCCTGCGCCAGCGTTCGCAGCGCCTGCTGGGCACC
GTCGCCGGCGTCGTCGGAGTCTGCTGGCTGCTGGGGATGTTGTGGGTCTGGCACGAGGATTCGCGTGAAG
CACAAGCCCTCGGCCAGCGTATCCAGGCCATGCAGCATGGGTCGGGTGAGGGTTCGGCGAGCGCCACGGC
GCCGGTCGATGCCGCGCGGCTGCGCCTGCAAGCGTACTGGGCACTGCTGCAGGGGGCGCCGCGCTGGCAT
TACCGGTCGCTGGTGTACCCGAGCTCCTGGTTCTCCGGTTTCGACAGCCAGATGGACGAACTGCTCAGGG
ATCTGACCCGGCGCGAGGTGCTGACGCCTCTGCAGCAAACCCAGGCCGCGGACCTGGTTCGGCTGCGCGT
CATCCGCAGCAGCGAACGTCGCGCCAACGTGCAGAGCGACAGCCCGGAGCAATGGCCCAACTTCGTCGCC
GCGCGCGAGCTGGCCAGCGGCGTTCTGGCGTTCGAGCAGCGCAATCGCTGGTACAACGAACTGCGTACCG
GCACCTCGAAGAATCCCCTGGAAAGCCTCGCCAGGCTGGGTGAGCAGACCTATGGCCTGACGCTCGAACC
AGGAACGTTGCGCAACGCCCGCTACTTGCAGTCGGTACTCGGGAAGGGCATTCCCGAGGCACCCGCGCCG
GTCGACCCCGGCCCCCGGGATGGCCCGCTGGCGCGCAATTTCGACGACCTGATGGGGCTCTGGCTCGACC
AGTTCTTCCTCTCCGACAACTTCGTGCGCCCGGCCGGCTTCCTGCGTCTGCACCTGAACGAGCTCAAGGC
GCGGCAAGGCAACAGCCTGGAGGAGCTGGAGGAAACCGCCGCGCAGATCGATGCCCTGCGCAACATGGTG
GCATTGACCAACGCCGCCTGGAGTCATGGCAATGCCCAGGAGATTGTCCCCGGTTATCGGGCGCTGCTGG
ACGACGTGCGCCAGTCCTACCTGCTCGGGCCTGCGGCGGAAGCGACGGTGACCAGCCAGGCGAGCAAGCT
GCAGCGCACCTTCCACGACCAGTGGATCGCCGCCGCCGGTTCCCGCGATAACCTGCTGCAACTTCAACCC
GGCGGAACCCTGGCGCTACAGGAGCATGTGGTGGCGCTGGGCAGCGCCATCGAGTCGCTGATGCGCCAGG
ATTTCGCCGGTACCGCCCTGCGTCAGCAGGAGCAGGAAATCGATCCGCGCCGCCTCGGCAACCTGGACGC
CCACGCCCTGAATGCCGCGCTTGCGTACTACGACAGCTATCGCAAGTACAGCGAACAGGAGCAGGCGCGG
ATACCGGCCGAGTACCGCGACGCCCTCGCCGGAAGCGCCGCCGCCGCCACGGCCAGCGCCATGTGGAGCA
GCCTGAGCCAATCCGTGCCATCGAGCGGGGCTGCTGCGCAAATCACCTTCGACGTCCCGCTGGAGCCGGC
GCAGCAGGTGCGCCAGGCACTGGAATCCTTGCAGCGCAACGATCTGGCCAATGCGCTGGATATCCACCTG
ACCCGTGGCGCGCTGGCCGACGTCGACACCGTACTGAAGTCGATCGACGCATTGCCGTTGTTCCGCGTGC
GTTCGGAGCTGTCCGGTTGGGACGGCTCGCGCAATTTCGGCCTGCAGCTCTATCGTTCCACCGACACCCA
GGACCTCAAGCGCAGCCTGGCCCAGCAGTTCGAAAGCATGCTCACCCTGAGCGAGGAACATGCGCCCGCG
CTGACCTGGCTCAGGGACCGGGGCAACCTCGGCTTCGCCGATCAGGACAAGGTGCGGCGCTTCGCCAACC
TCAGCGATGAGCTGAGCAAGTACAAGGCGCAGAACCCGACGAGCTCGCCCATGCTGCTGGATCAGCTGGT
CACCCGCGACTTCGTGGAAATGGACGCGGCAAGTTGCGCCAATATCCTGCGTACCTCGGCGCTGGTCCCT
GGGCAGGGCGACGTGGCGCGGTTCACCCGTGGTCTTCACAGTCAGGCGCAGCAGCGTTGCCTGGAGTTGC
AGCAGAAGGGGGCTGCCGCGGCCTGGTCCGCCATTGCCGACTACTTCAACCAGTACCTGGCCAACCGCTT
CCCCTTCGCCTACAGCCTGCAAGCCGAAGATGCGGATCCGGCACGGGTGCAGCACCTGGTGGAACTGCTC
GACCAGAACCTCGCGCGGGCCCAGGAGGGCCTGAAACTCAGCCAGTCGGTGGACCGCACGGCGGCGACGG
ATTTCCTCCAGCGCCTGCAACTGGCCAGGGCCTGGATGGGCCCGCTGTTCCAGCGTGACAAGGGCGGAGC
GCGGGGTGTCGATCTCGACGTGCGTTGGCGCACCGACCGCGAAGCCGAGCGTGGCGCCGACCAGGTCATC
GCCTGGACGCTCTATGCCGCCGACCGATCGCTGAGCTTCCCCGGCGGCGATGGCCAGCGCCTGCACTGGA
ATGTCGGCGAGCCGGTGAAGGTGCTGCTGCGCTGGGCCAAGGACAGCCCGCAGCGGCCGGACATCGACCC
GCAGCAGGCGAGCATGGCGGTGGCCGACCTGGAAGTGGGCTGGGAGTACAGTGGTCCCTGGGCCCTGATC
CGTATGCTGCGCTCGCACCTGATCCTGCAACGCCAGCCCAGCGCCGACTACACCGACTTCCCGTTGGCGC
TGCGGGTGCCGATCCGCTCTCCCAACAGCCACGAGCCCGAGGCGCGGATGTTCCTGCGAGTCTCCCTGAT
GACCCCGGACGCCAAGCAGCCACTCTCGATCCAGCCGCTTCCGGTGCGCGCGCCGCGCACGCCCTTCAGC
GGTGTCGGCATTGCGACCTTTGCCGGCACCCAGGAGTTGCCATGA
 Primer design