SecReT6
Protein ID: 472326135
SecReT6 ID744
T6SS typei4a
Gene symbol-
Locus tagH681_14865
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]3355653..3356423 [-]
Producttype VI secretion protein DotU
NoteTssL
UniProt IDM4WZZ1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.20E-40, Aligned region: 17..231
Protein Sequence: 256 a.a.     [Download]
>gi|472326135|ref|YP_007658381.1| type VI secretion protein DotU [Pseudomonas denitrificans ATCC 13867]
MPEGNQAIYPPSFGEAPLSHAFQVAWLDWRQRWDSLRDSVGEQDALIERVSEEAQAVVRRLWRSAFGSVG
EAAGEQVKGMVYAFVALLDENLLFDPWNGQAAWQERPLESRLYGTRNAGERVPQAIHRLLETRAPGTRDL
ANVYLQCLLLGFHGRLRGPKGEALHEKWRHALFAHAWQRDAEAPALLETLARPASAAALRLPLRRTLPDG
LRLTLMVAAGTLLLIVLGHWLWSDVRGELTPLLDLACSVTATERMG
 
Nucleotide Sequence: 771 bp     [Download]
>gi|472323176|ref|NC_020829.1|:c3356423-3355653 Pseudomonas denitrificans ATCC 13867, complete genome
ATGCCCGAAGGGAATCAGGCGATCTATCCTCCATCGTTCGGCGAAGCCCCGTTGAGCCACGCGTTCCAGG
TCGCCTGGCTGGACTGGCGGCAGCGTTGGGACAGCCTGCGGGACTCGGTCGGCGAGCAGGACGCGCTCAT
CGAACGGGTTTCCGAGGAGGCCCAGGCGGTCGTGCGCCGCCTGTGGCGCAGCGCCTTCGGCAGTGTCGGC
GAGGCCGCCGGCGAGCAGGTCAAGGGCATGGTCTACGCCTTCGTTGCACTGCTCGACGAGAACCTGCTGT
TCGATCCCTGGAACGGTCAGGCGGCCTGGCAGGAGCGGCCGCTCGAGTCCCGCCTGTACGGCACGCGCAA
TGCCGGGGAGCGCGTTCCCCAGGCCATCCACCGGTTGCTGGAAACGCGCGCGCCGGGTACGCGCGATCTC
GCCAATGTCTACCTGCAATGCCTGTTGCTGGGGTTCCACGGACGGCTGCGCGGCCCGAAGGGCGAAGCCC
TGCATGAGAAGTGGCGGCATGCGCTGTTCGCCCATGCCTGGCAGCGCGACGCCGAAGCACCGGCGCTGCT
GGAGACCCTGGCGCGCCCGGCAAGCGCCGCGGCCCTGCGCCTGCCGTTGCGCCGCACCTTGCCCGATGGT
TTGCGGCTGACGCTGATGGTGGCGGCCGGCACCCTGCTGCTCATCGTCCTCGGTCACTGGCTGTGGAGCG
ACGTGCGCGGCGAACTGACGCCGCTGCTGGACCTCGCCTGCTCGGTTACCGCCACGGAGCGGATGGGGTG
A
 Primer design