SecReT6
Protein ID: 472326136
SecReT6 ID744
T6SS typei4a
Gene symbol-
Locus tagH681_14870
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]3356436..3357725 [-]
Producthypothetical protein
NoteTssK
UniProt IDM4X1C4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.30E-58, Aligned region: 7..402
Protein Sequence: 429 a.a.     [Download]
>gi|472326136|ref|YP_007658382.1| hypothetical protein H681_14870 [Pseudomonas denitrificans ATCC 13867]
MQLLPQHFQLQGLRAEVLSARLAHAANPWFWGLEHLELDPSALSGGVVRILALEAILPDGLPVSLGQGDT
LVFDATAAVAGSVDAGITLYLALSPLARGGQVLPLKGRLQSASGPAVPDLASGENPEPIVVWRPAPRLVT
EAQRADSVCLPLLRIGKDAGGFVCLPYVAPTPRIAPASPLGQALVGLCARAREKCVFLAGRLRQAQQAEN
TEDSQEIRRQLAALWSRLPELEAALYSGAASPAHLHGLLCGMTGSWSVLDPLGGVPAFPTFDFNELLRTF
TPVIEWLEVTLGRVRAGYRSLAFERSGHDFALALPDLSSPVQRLVIGLRMPPGCGEEQAHEWLSRCIVAS
EASLAILGRQRMSGLEHLPMSRAEQIAYSVGEDTHLFVVQAEGDWFDPAQRLCLRASALGTGNGPWQVVL
FIVDGAGGA
 
Nucleotide Sequence: 1290 bp     [Download]
>gi|472323176|ref|NC_020829.1|:c3357725-3356436 Pseudomonas denitrificans ATCC 13867, complete genome
ATGCAACTGCTTCCCCAGCACTTCCAGTTGCAGGGGTTGCGCGCCGAAGTGTTGTCCGCGCGCCTGGCCC
ATGCGGCCAATCCCTGGTTCTGGGGGCTCGAACACCTGGAGCTGGACCCTTCCGCACTGAGTGGCGGCGT
GGTGCGCATCCTGGCGCTGGAGGCGATCCTTCCCGATGGCTTGCCGGTCAGCCTGGGGCAGGGCGATACG
CTGGTCTTCGATGCCACCGCGGCCGTCGCCGGTTCCGTCGATGCCGGCATCACTCTCTACCTGGCTCTCA
GTCCGCTGGCTCGTGGCGGCCAGGTGTTGCCGCTGAAGGGGCGCCTGCAGTCTGCCAGCGGGCCGGCGGT
GCCGGACCTGGCCAGTGGCGAGAATCCCGAACCCATCGTGGTCTGGCGCCCGGCGCCGCGCCTGGTGACC
GAGGCGCAACGCGCCGATTCGGTGTGCCTGCCGCTGTTGCGCATCGGCAAGGATGCCGGCGGTTTCGTCT
GCCTGCCTTATGTCGCGCCGACACCGCGGATCGCGCCGGCTTCACCGCTGGGCCAGGCGCTGGTGGGGCT
GTGCGCCCGTGCGCGGGAGAAGTGCGTGTTCCTTGCCGGCCGCCTGCGCCAGGCGCAGCAGGCGGAGAAC
ACCGAGGACAGCCAGGAAATCCGCCGCCAGCTGGCTGCGCTCTGGTCACGGCTACCGGAGCTTGAGGCGG
CGCTCTACAGCGGCGCGGCGAGCCCGGCGCACCTGCACGGGCTGTTGTGCGGCATGACCGGCAGTTGGAG
CGTGCTGGACCCGCTGGGCGGCGTGCCGGCTTTCCCGACCTTCGACTTCAACGAACTGCTGCGTACTTTC
ACTCCAGTGATCGAGTGGCTGGAAGTGACCCTCGGGCGGGTGCGCGCAGGCTACCGCAGCCTGGCCTTCG
AGCGTTCGGGGCATGACTTCGCCCTGGCCCTGCCGGACCTGAGCTCGCCGGTCCAGCGCCTGGTCATCGG
CTTGCGCATGCCGCCGGGCTGCGGTGAGGAGCAGGCGCACGAGTGGTTATCGCGCTGCATCGTCGCTTCC
GAAGCGAGCCTGGCGATACTGGGCCGGCAACGCATGTCGGGGCTCGAACATCTGCCCATGAGCCGCGCTG
AGCAGATCGCCTACAGCGTGGGCGAGGACACCCACCTGTTCGTCGTGCAGGCCGAGGGCGACTGGTTCGA
TCCTGCACAGCGCCTGTGCCTGCGGGCGTCCGCCCTGGGAACTGGCAACGGCCCCTGGCAGGTGGTGCTG
TTCATCGTGGACGGCGCCGGCGGCGCCTGA
 Primer design