SecReT6
Protein ID: 472326138
SecReT6 ID744
T6SS typei4a
Gene symbol-
Locus tagH681_14880
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]3358504..3359076 [+]
Producthypothetical protein
NoteTssB
UniProt IDM4WYF7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.90E-54, Aligned region: 9..161
Protein Sequence: 190 a.a.     [Download]
>gi|472326138|ref|YP_007658384.1| hypothetical protein H681_14880 [Pseudomonas denitrificans ATCC 13867]
MAESTQHKLDRVRPPRVQITYDVEIGNAIEKKELPLVLGILSDLSGKPDTPLPKLSERRFTEIDRDNFNA
VLSSIGPRVALQVDNTLANDGSKLNVELNFKHIDDFDPVSIVNQVVPLRRLFEARQRLRDLLTKLDGNDE
LDQLLQDVVSNTEGLQEIRATHPVSAEAGAADDAAQAADDDGEAPTEPQA
 
Nucleotide Sequence: 573 bp     [Download]
>gi|472323176|ref|NC_020829.1|:3358504-3359076 Pseudomonas denitrificans ATCC 13867, complete genome
ATGGCAGAAAGCACACAGCACAAGCTGGACCGGGTGCGCCCACCCAGGGTCCAGATCACCTACGACGTCG
AAATCGGCAACGCCATCGAGAAGAAGGAACTGCCCCTGGTGCTCGGCATCCTCTCCGACCTCTCGGGCAA
GCCCGACACTCCCCTGCCCAAGCTCAGCGAACGCCGCTTCACCGAAATCGACCGCGACAACTTCAATGCC
GTGCTGTCCTCCATCGGCCCGCGCGTGGCGCTGCAGGTGGATAACACCCTGGCCAACGACGGCAGCAAGC
TCAACGTCGAGCTGAACTTCAAGCATATCGACGACTTCGACCCGGTGAGCATCGTCAACCAAGTGGTCCC
CCTGCGACGGCTGTTCGAGGCCCGCCAGCGCCTGCGCGACCTGCTCACCAAGCTCGACGGCAACGATGAG
CTGGACCAGTTGCTGCAGGACGTGGTGAGCAACACCGAGGGTCTGCAGGAAATCCGCGCGACCCACCCGG
TGAGTGCCGAGGCCGGCGCCGCCGACGACGCTGCCCAGGCCGCCGACGACGACGGCGAAGCACCCACCGA
ACCACAAGCCTGA
 Primer design