SecReT6
Protein ID: 472326139
SecReT6 ID744
T6SS typei4a
Gene symbol-
Locus tagH681_14885
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]3359101..3360588 [+]
Producthypothetical protein
NoteTssC
UniProt IDM4XHR2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.20E-190, Aligned region: 67..490
Protein Sequence: 495 a.a.     [Download]
>gi|472326139|ref|YP_007658385.1| hypothetical protein H681_14885 [Pseudomonas denitrificans ATCC 13867]
MAKPSSAAAQGAEGSTQTLDLLDHIIAEGRMAHDDSQQEYARDMLAEFATQVLDEGMSVSKDTVAMINER
IGRIDELISAQLNQILHHPEVQQLESSWRGLHQLVQNSETGARLKLRLLNVSQQDLQNDLEKAVEFDQSA
LFKKIYEEEYGTFGGHPFSLLLGDYSFGRHPQDIALLEKLSNVAAAAHAPFIAAASPRLFDMGSFTELAV
PRDLSKVFESLELIKWRSFRESEDSRYVSLALPRFLVRLPYGPETLPVEGMNFIEDVDGSDHAKYLWGNA
AWVLAQRITDAFSKYGWCAAIRGSEGGGAVEGLPAHTFRTQAGDLSLKCPTEVAITDRREKELNDLGFIA
LCHKKNTDLAVFFGGQSTNKPRQYNTNEANANARLSAMLPYVLAASRFAHYLKVIMRDKVGSFMTRDNVQ
TYLNNWIADYVLINDNAPQEIKAQYPLREARVDVSEVAGKPGVYRATVFLRPHFQLEELTASIRLVASLP
PPVAA
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|472323176|ref|NC_020829.1|:3359101-3360588 Pseudomonas denitrificans ATCC 13867, complete genome
ATGGCCAAACCCAGTTCGGCTGCGGCGCAAGGCGCCGAAGGCAGCACCCAGACCCTCGACCTGCTCGACC
ACATCATCGCCGAAGGCCGCATGGCCCACGACGACAGCCAGCAGGAATATGCCCGCGACATGCTCGCGGA
GTTCGCCACCCAGGTCCTCGACGAAGGCATGAGCGTCAGCAAGGACACCGTGGCCATGATCAACGAGCGC
ATCGGCCGCATCGACGAGCTGATCAGCGCCCAGCTCAACCAGATCCTGCACCATCCCGAGGTGCAGCAAC
TCGAATCCTCCTGGCGCGGCCTGCACCAGTTGGTGCAGAACAGCGAGACCGGCGCGCGGCTGAAACTGCG
CCTGCTCAACGTCAGTCAGCAGGACCTGCAGAACGACCTGGAGAAGGCCGTCGAGTTCGACCAGAGCGCG
CTGTTCAAGAAGATCTACGAAGAGGAATACGGCACCTTCGGCGGCCACCCGTTCAGCCTGCTGCTGGGCG
ACTACTCCTTCGGCCGTCACCCGCAGGACATCGCCCTGCTGGAGAAACTCTCCAACGTCGCCGCCGCCGC
CCATGCGCCCTTCATCGCCGCCGCCAGCCCGCGCCTGTTCGACATGGGCAGCTTCACCGAACTGGCGGTG
CCGCGCGACCTGAGCAAGGTCTTCGAGAGCCTGGAGCTGATCAAGTGGCGCTCGTTCCGCGAGAGCGAGG
ATTCGCGCTACGTCTCCCTGGCGCTGCCGCGCTTCCTGGTGCGCCTGCCCTACGGCCCGGAAACCCTGCC
GGTGGAAGGCATGAACTTCATCGAGGACGTGGACGGCAGCGACCACGCCAAATACCTCTGGGGCAACGCC
GCCTGGGTCCTGGCCCAGCGCATCACCGATGCCTTCAGCAAGTACGGCTGGTGCGCGGCGATCCGCGGCA
GCGAAGGTGGCGGCGCCGTCGAAGGCCTGCCGGCACATACCTTCCGCACCCAGGCCGGCGACCTGTCGCT
CAAGTGCCCGACCGAGGTGGCGATCACCGACCGCCGCGAGAAGGAGCTCAACGACCTGGGCTTCATCGCC
CTGTGCCACAAGAAGAACACCGACCTCGCGGTGTTCTTCGGTGGCCAGTCCACCAACAAGCCGCGCCAGT
ACAACACCAACGAGGCCAACGCCAACGCGCGGCTCTCGGCGATGCTGCCGTACGTGCTGGCGGCCTCGCG
CTTCGCCCACTACCTGAAGGTGATCATGCGCGACAAGGTGGGCAGCTTCATGACCCGCGACAACGTGCAG
ACCTACCTCAACAACTGGATCGCCGACTACGTGCTGATCAACGACAACGCCCCGCAGGAGATCAAGGCGC
AGTACCCGCTGCGCGAAGCCCGCGTGGACGTCAGCGAGGTCGCCGGCAAGCCCGGGGTCTACCGCGCCAC
GGTGTTCCTGCGGCCGCACTTCCAGCTGGAAGAACTGACCGCCTCGATCCGCCTGGTAGCCAGCCTGCCG
CCGCCGGTCGCCGCCTGA
 Primer design