SecReT6
Protein ID: 472326140
SecReT6 ID744
T6SS typei4a
Gene symbol-
Locus tagH681_14890
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]3360662..3361159 [+]
Producthypothetical protein
NoteTssD
UniProt IDM4WZZ7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.00E-36, Aligned region: 10..139
Protein Sequence: 165 a.a.     [Download]
>gi|472326140|ref|YP_007658386.1| hypothetical protein H681_14890 [Pseudomonas denitrificans ATCC 13867]
MDAILLDLGDDIKGDSLLAGFEDKIEIMSYSHNVAMQVTNDVSNSERTSGKPHIGEFTLTKFVDTSTPTL
NEYCCSGKAIPTAILTIGRNAAEGDGKVMPFITYTLNNVVLSNVSVSGGAGGKPVETLSLNFTKIKWELT
AQKDDGSKEGTAASTWDMAANKLAS
 
Nucleotide Sequence: 498 bp     [Download]
>gi|472323176|ref|NC_020829.1|:3360662-3361159 Pseudomonas denitrificans ATCC 13867, complete genome
ATGGATGCGATACTTCTCGACCTGGGCGACGACATCAAGGGCGACAGCCTGCTGGCCGGCTTCGAAGACA
AGATCGAAATCATGTCCTACAGCCACAACGTCGCCATGCAGGTGACTAACGATGTCAGCAACTCCGAGCG
CACCTCCGGCAAGCCGCATATCGGCGAGTTCACCCTGACCAAGTTCGTCGACACCTCCACCCCGACGCTC
AACGAATACTGCTGCTCCGGCAAAGCCATCCCCACCGCCATCCTCACCATCGGGCGCAACGCCGCCGAAG
GCGACGGCAAGGTCATGCCCTTCATCACCTACACCCTGAACAACGTGGTGCTGTCCAACGTCAGCGTCAG
CGGCGGCGCCGGCGGCAAGCCGGTGGAAACCCTGTCGCTGAACTTCACCAAGATCAAATGGGAGCTCACC
GCGCAGAAGGACGACGGCAGCAAGGAAGGCACCGCCGCCTCGACCTGGGACATGGCCGCCAACAAGCTGG
CCAGCTAA
 Primer design