SecReT6
Protein ID: 472326141
SecReT6 ID744
T6SS typei4a
Gene symbol-
Locus tagH681_14895
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]3361172..3361600 [+]
Producthypothetical protein
NoteTssE
UniProt IDM4X1D0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-17, Aligned region: 26..118
Protein Sequence: 142 a.a.     [Download]
>gi|472326141|ref|YP_007658387.1| hypothetical protein H681_14895 [Pseudomonas denitrificans ATCC 13867]
MQSIGRPPLLDRLADSGGADPTFDSRALAASVAQELSRLLNSRSPAGNGVGILAYGIADWTALQARREAD
RLHLAREIRRAVTRFEPRLGLSEVVVDADPLQPQRLRVRLLGNLRQDTSRAPLLFELIPVGGTLEVRHER
LD
 
Nucleotide Sequence: 429 bp     [Download]
>gi|472323176|ref|NC_020829.1|:3361172-3361600 Pseudomonas denitrificans ATCC 13867, complete genome
TTGCAAAGCATCGGTCGGCCTCCGCTGCTGGACCGCCTCGCCGACTCCGGAGGGGCGGACCCGACCTTCG
ACAGCCGCGCATTGGCGGCCTCGGTCGCGCAGGAACTGTCGCGCCTGCTCAACAGCCGCAGCCCGGCCGG
CAATGGCGTCGGTATCCTCGCCTACGGCATCGCCGACTGGACCGCCCTGCAAGCCCGCCGCGAAGCCGAC
CGCCTGCACCTGGCACGGGAAATCCGTCGCGCGGTGACCCGCTTCGAACCACGCCTGGGGCTGAGCGAAG
TGGTGGTCGACGCCGACCCGCTCCAGCCGCAGCGCCTGCGCGTGCGCCTGCTCGGCAACCTGCGCCAGGA
CACCAGCCGCGCACCGCTGCTGTTCGAACTCATCCCCGTTGGCGGAACACTGGAAGTACGCCATGAGCGA
CTCGATTGA
 Primer design