SecReT6
Protein ID: 472326142
SecReT6 ID744
T6SS typei4a
Gene symbol-
Locus tagH681_14900
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]3361584..3363410 [+]
Producttype VI secretion protein VasA
NoteTssF
UniProt IDM4WXD2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-179, Aligned region: 9..605
Protein Sequence: 608 a.a.     [Download]
>gi|472326142|ref|YP_007658388.1| type VI secretion protein VasA [Pseudomonas denitrificans ATCC 13867]
MSDSIDAELLDYYQSELTWLRHAGAGFAARYPKVARRLELGPGECGDPHVERLLEGFALLAARLQRRLDD
DYAQFSDALLEQLYPLALRPLPSCAVVRFEPDPAKGNLSAGYRLPRGTPLFVSVPGQERIELPDELRGQT
LHWRTADEVTLWPLRIAEAVLLGAEEAQAATGVAGIRSALRLDLRCLDKDGWAALGIDSLRIHLTANAVA
KAALYDLLGAHACGLIAKAEGAEPQRLASLPQRVGFAAEQALLPEDDRVHPGLRLLAEYFAFPDKFAFFD
VPLHGLRASGEQLYLYILFDRPAPARLTLQASDLALGCVPAINLFPRTSEPLRPDGTRSEYRLVADAHRE
NSVEIHSIRSLRASTPQGVVEVAPYHGTQHRPGAFGLYWHARRVEGMTPNRRGSDLLLSLVDAGLQPLEE
TPQYSLSAELLCTNRSLAEYLPAGTELSFERPGPVARATLLRAPSRQSQPALDGPSRWQLVSQLTLNHLS
LVEGPQALDALREILALHDFSEDKLASRQIEGLVALDCERVVDHVGSDAWRGWRNGLEVRVHLERQAFVG
ASAVLFSAVLAQFFSLYANANRFVRTVLVQSDQEICRWQPQAGQPITL
 
Nucleotide Sequence: 1827 bp     [Download]
>gi|472323176|ref|NC_020829.1|:3361584-3363410 Pseudomonas denitrificans ATCC 13867, complete genome
ATGAGCGACTCGATTGACGCCGAACTGCTGGATTACTACCAGAGCGAACTGACCTGGCTGCGCCACGCCG
GCGCTGGATTCGCCGCGCGCTATCCCAAGGTGGCGCGACGCCTGGAACTGGGCCCCGGCGAGTGTGGCGA
CCCGCACGTCGAGCGCCTGCTGGAAGGCTTCGCGCTGCTCGCCGCGCGCCTGCAACGGCGCCTGGACGAC
GATTACGCGCAGTTCAGCGACGCCCTGCTGGAACAGCTCTACCCCCTCGCCCTGCGGCCCCTGCCCTCCT
GCGCCGTGGTGCGTTTCGAGCCGGACCCGGCCAAGGGCAACCTGAGCGCCGGCTACCGCCTGCCACGCGG
CACGCCACTGTTCGTCAGCGTGCCGGGCCAGGAGCGCATCGAACTGCCCGACGAGCTGCGCGGCCAGACC
CTGCACTGGCGCACCGCCGACGAAGTCACGCTGTGGCCGCTGCGCATCGCCGAGGCCGTGCTGCTGGGAG
CCGAAGAAGCCCAGGCCGCCACCGGCGTCGCCGGCATCCGCTCCGCCCTGCGTCTCGACCTGCGCTGCCT
CGACAAGGACGGCTGGGCGGCACTGGGCATCGACAGCCTGCGCATCCACCTGACCGCCAACGCCGTCGCC
AAGGCCGCCCTCTACGACCTGCTCGGCGCCCATGCCTGCGGCCTCATCGCCAAGGCCGAGGGCGCCGAAC
CGCAACGCCTTGCCAGCCTGCCGCAACGGGTCGGCTTCGCCGCCGAACAGGCCCTGCTGCCCGAGGACGA
CCGCGTCCACCCCGGCTTGCGCCTGCTCGCCGAGTACTTCGCCTTCCCCGACAAGTTCGCCTTCTTCGAC
GTGCCGCTGCACGGCCTGCGCGCCAGCGGCGAGCAGCTGTATCTCTACATCCTCTTCGATCGCCCCGCCC
CCGCCCGCCTGACCCTGCAGGCCAGCGACCTGGCGCTGGGCTGCGTGCCGGCGATCAACCTGTTCCCGCG
CACCTCCGAGCCGCTGCGGCCGGACGGTACGCGCAGCGAATACCGGCTGGTCGCCGACGCCCACCGCGAG
AACTCGGTGGAAATCCACAGCATCCGCTCGCTGCGCGCCAGCACCCCGCAGGGCGTGGTCGAGGTCGCGC
CCTACCACGGCACCCAGCACCGCCCCGGCGCATTCGGCCTCTACTGGCACGCACGGCGAGTCGAGGGCAT
GACACCCAACCGGCGCGGCAGCGACCTGTTGCTGAGCCTGGTCGACGCCGGCCTGCAACCGCTGGAAGAG
ACTCCGCAGTACAGCCTCAGCGCCGAACTGCTGTGCACCAACCGCAGCCTGGCCGAATACCTGCCGGCGG
GCACCGAACTGTCCTTCGAACGGCCCGGCCCGGTGGCCCGCGCCACCTTGCTGCGGGCACCGAGCCGGCA
ATCCCAGCCAGCCCTGGACGGCCCCTCGCGCTGGCAACTGGTCTCGCAACTGACGCTCAACCACCTATCC
CTGGTGGAGGGTCCGCAGGCCCTTGACGCCCTGCGGGAAATCCTCGCGCTGCACGATTTCAGCGAAGACA
AACTCGCCTCGCGCCAGATCGAGGGACTGGTGGCGCTGGATTGCGAGCGCGTGGTCGACCATGTCGGCAG
CGACGCCTGGCGCGGCTGGCGCAACGGCCTGGAAGTACGCGTGCACCTGGAGCGCCAGGCCTTCGTCGGC
GCCAGCGCGGTGCTGTTCAGCGCCGTGCTCGCACAGTTCTTCTCGCTGTACGCCAACGCCAACCGCTTCG
TGCGCACGGTGCTGGTGCAATCGGACCAGGAGATTTGCCGATGGCAACCCCAGGCCGGCCAGCCCATCAC
TCTCTGA
 Primer design