SecReT6
Protein ID: 472326143
SecReT6 ID744
T6SS typei4a
Gene symbol-
Locus tagH681_14905
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]3363374..3364387 [+]
Producthypothetical protein
NoteTssG
UniProt IDM4WYG2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.00E-80, Aligned region: 17..318
Protein Sequence: 337 a.a.     [Download]
>gi|472326143|ref|YP_007658389.1| hypothetical protein H681_14905 [Pseudomonas denitrificans ATCC 13867]
MATPGRPAHHSLSRRLRAEPHRFEWLQALLLLEHEQPQATPLGHGSRPDAEALRLRGPLTPVFAPSQIDA
LEDEDGRPLLSTSIFGLGGADGALPYAYQEWLQQRARQKDHAPGEFLDLFQHRLLSLLYRVLRKHRLAVG
FQAPAEAPLRQPLRALVGLLPAALHERGPLPDASVLARSAHFAGNRRSLVGFAVILREQFGIPAQCEAYA
GAWREIPPARRSMLKRGGANLGLGRDAIAGTRVWDEHAGFHLRLGPLDETTARHFLPDGAAYPLLAHLCA
LYFGPDLDCRLRLLVRASGPLALGRGNAPRLNWNTGLRRSGGAVQPIDLTLRHAEMP
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|472323176|ref|NC_020829.1|:3363374-3364387 Pseudomonas denitrificans ATCC 13867, complete genome
ATGGCAACCCCAGGCCGGCCAGCCCATCACTCTCTGAGCCGGCGCCTGCGCGCCGAGCCGCATCGTTTCG
AGTGGCTGCAGGCCCTGCTCCTGCTGGAGCACGAACAACCCCAGGCAACGCCCCTGGGCCACGGTAGCCG
TCCGGATGCCGAAGCGCTGCGCCTGCGCGGGCCGCTGACGCCGGTCTTCGCCCCCAGCCAGATCGATGCA
CTGGAAGACGAGGACGGCCGGCCGCTGCTGAGCACCTCCATCTTCGGCCTGGGCGGGGCCGACGGCGCCC
TGCCCTACGCTTACCAGGAGTGGCTGCAGCAGCGCGCACGGCAGAAGGATCATGCGCCTGGCGAGTTCCT
CGACCTGTTCCAGCACCGCCTGCTCAGCCTGCTCTACCGGGTGTTGCGCAAGCACCGGCTGGCCGTGGGT
TTCCAGGCACCGGCAGAGGCTCCCCTGCGACAGCCGCTGCGCGCCCTGGTCGGCCTGCTGCCTGCGGCCC
TGCACGAGCGCGGCCCGCTACCCGACGCCAGCGTCCTCGCCCGCAGTGCGCACTTCGCCGGCAATCGCCG
CTCACTGGTCGGCTTCGCCGTCATACTCCGCGAACAGTTCGGCATTCCCGCCCAGTGCGAAGCCTATGCC
GGCGCCTGGCGCGAGATCCCCCCGGCCAGGCGCAGCATGCTGAAGCGCGGCGGCGCCAACCTCGGGCTGG
GCCGCGACGCCATCGCCGGTACCCGCGTCTGGGACGAGCACGCCGGCTTCCACCTGCGCCTCGGCCCGCT
GGACGAAACCACCGCCCGGCACTTCCTCCCCGATGGTGCCGCCTATCCATTGCTGGCACATCTGTGCGCG
CTGTACTTCGGCCCCGACCTCGACTGCCGGCTGCGCCTGCTGGTGCGCGCCAGCGGGCCGCTCGCCCTCG
GTCGCGGCAATGCCCCACGGCTGAACTGGAACACCGGCCTGCGCCGCAGCGGCGGCGCCGTGCAGCCCAT
CGACCTGACCCTGCGCCACGCGGAGATGCCCTGA
 Primer design