SecReT6
Protein ID: 472326144
SecReT6 ID744
T6SS typei4a
Gene symbol-
Locus tagH681_14910
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]3364387..3366936 [+]
Producttype VI secretion ATPase
NoteTssH
UniProt IDM4XHS0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.40E-37, Aligned region: 222..241
AAA_2 [PF07724], Evalue: 2.40E-37, Aligned region: 611..775
AAA [PF00004], Evalue: 3.00E-20, Aligned region: 220..331
AAA [PF00004], Evalue: 3.00E-20, Aligned region: 472..497
AAA [PF00004], Evalue: 3.00E-20, Aligned region: 617..734
AAA_5 [PF07728], Evalue: 2.10E-15, Aligned region: 220..240
AAA_5 [PF07728], Evalue: 2.10E-15, Aligned region: 318..350
AAA_5 [PF07728], Evalue: 2.10E-15, Aligned region: 616..735
Clp_N [PF02861], Evalue: 2.00E-10, Aligned region: 21..72
Clp_N [PF02861], Evalue: 2.00E-10, Aligned region: 104..125
AAA_22 [PF13401], Evalue: 7.00E-10, Aligned region: 220..301
AAA_22 [PF13401], Evalue: 7.00E-10, Aligned region: 336..397
AAA_22 [PF13401], Evalue: 7.00E-10, Aligned region: 615..720
AAA_16 [PF13191], Evalue: 5.10E-09, Aligned region: 15..55
AAA_16 [PF13191], Evalue: 5.10E-09, Aligned region: 197..241
AAA_16 [PF13191], Evalue: 5.10E-09, Aligned region: 265..298
AAA_16 [PF13191], Evalue: 5.10E-09, Aligned region: 483..545
AAA_16 [PF13191], Evalue: 5.10E-09, Aligned region: 601..657
AAA_16 [PF13191], Evalue: 5.10E-09, Aligned region: 681..708
AAA_25 [PF13481], Evalue: 7.10E-06, Aligned region: 220..244
AAA_25 [PF13481], Evalue: 7.10E-06, Aligned region: 275..317
AAA_25 [PF13481], Evalue: 7.10E-06, Aligned region: 613..641
AAA_25 [PF13481], Evalue: 7.10E-06, Aligned region: 787..804
ClpB_D2-small [PF10431], Evalue: 7.50E-06, Aligned region: 781..848
Zeta_toxin [PF06414], Evalue: 1.80E-05, Aligned region: 220..240
Zeta_toxin [PF06414], Evalue: 1.80E-05, Aligned region: 609..656
AAA_14 [PF13173], Evalue: 2.10E-05, Aligned region: 220..300
AAA_14 [PF13173], Evalue: 2.10E-05, Aligned region: 615..706
AAA_19 [PF13245], Evalue: 2.40E-05, Aligned region: 14..25
AAA_19 [PF13245], Evalue: 2.40E-05, Aligned region: 217..246
AAA_19 [PF13245], Evalue: 2.40E-05, Aligned region: 613..638
Sigma54_activat [PF00158], Evalue: 2.80E-05, Aligned region: 216..234
Sigma54_activat [PF00158], Evalue: 2.80E-05, Aligned region: 243..260
Sigma54_activat [PF00158], Evalue: 2.80E-05, Aligned region: 615..733
IstB_IS21 [PF01695], Evalue: 3.90E-05, Aligned region: 214..239
IstB_IS21 [PF01695], Evalue: 3.90E-05, Aligned region: 616..636
AAA_17 [PF13207], Evalue: 6.70E-05, Aligned region: 220..261
AAA_17 [PF13207], Evalue: 6.70E-05, Aligned region: 461..461
AAA_17 [PF13207], Evalue: 6.70E-05, Aligned region: 617..653
AAA_18 [PF13238], Evalue: 9.80E-05, Aligned region: 220..243
AAA_18 [PF13238], Evalue: 9.80E-05, Aligned region: 618..651
T2SE [PF00437], Evalue: 0.00018, Aligned region: 208..236
T2SE [PF00437], Evalue: 0.00018, Aligned region: 570..694
NACHT [PF05729], Evalue: 0.00066, Aligned region: 220..247
NACHT [PF05729], Evalue: 0.00066, Aligned region: 616..641
ResIII [PF04851], Evalue: 0.0015, Aligned region: 205..240
ResIII [PF04851], Evalue: 0.0015, Aligned region: 285..301
ResIII [PF04851], Evalue: 0.0015, Aligned region: 616..638
AAA_29 [PF13555], Evalue: 0.002, Aligned region: 210..236
AAA_29 [PF13555], Evalue: 0.002, Aligned region: 612..641
RNA_helicase [PF00910], Evalue: 0.0025, Aligned region: 221..241
RNA_helicase [PF00910], Evalue: 0.0025, Aligned region: 617..638
AAA_28 [PF13521], Evalue: 0.0025, Aligned region: 220..239
AAA_28 [PF13521], Evalue: 0.0025, Aligned region: 437..522
AAA_28 [PF13521], Evalue: 0.0025, Aligned region: 616..636
Arch_ATPase [PF01637], Evalue: 0.0027, Aligned region: 198..234
Arch_ATPase [PF01637], Evalue: 0.0027, Aligned region: 272..305
Arch_ATPase [PF01637], Evalue: 0.0027, Aligned region: 615..658
SRP54 [PF00448], Evalue: 0.0075, Aligned region: 220..240
SRP54 [PF00448], Evalue: 0.0075, Aligned region: 615..645
AAA_23 [PF13476], Evalue: 0.0097, Aligned region: 220..237
AAA_23 [PF13476], Evalue: 0.0097, Aligned region: 459..488
AAA_23 [PF13476], Evalue: 0.0097, Aligned region: 614..642
Protein Sequence: 849 a.a.     [Download]
>gi|472326144|ref|YP_007658390.1| type VI secretion ATPase [Pseudomonas denitrificans ATCC 13867]
MDLASLIGRLNPESRRALERAAQRCLQRTHHYVEIEHLLLELLDIDGGDLARLLPRFGLERDQLVGEINT
ALELFRIGSTRTPALSTQTIGLLEDAVVQTSVLGQPTIRSGLLLLALLDREERRALLLNSASSLLRIPHE
TLREKLLEWTEGSREQPPSARTPDKTKPANAAAQDSVLDQYTQDLTADAHAGRIDPIVGRDGEIRQCVDI
LLRRRQNNPILVGAPGVGKTAVVEGLALRIAAGEVPPPLQGVILRVLDLGLLQAGAGVKGEFEQRLKGVI
DAVRSSEQPIILFIDEAHTLIGAGGAEGGSDAANLLKPALARGELRTLAATTWLEYKKYFEKDPALARRF
QLVQVEEPDEATAVDMLRGVAAKLEQHHGVQVLDVAIHDAVKLSHRYISGRQLPDKAISVLDTACARVAL
AQHDVPPALENLRHRELAVEEELQRLRREQATGLDHSTRITSLEQESVDNLAAIRALEKRWGEEREAVRE
LLQSRRELLTLSESADAAKPDEELDGRIDHLAAELARLEAGLDAIREDDPLVPEQVDSKTVAAVIAGWTG
IPVGKMLADEAHAIRTLAQRMSQRVMGQEAALGTIAQRIQAYRAGLTDPAKPVGVFLLLGPTGVGKTETA
YALADALYGGERNLISINLSEYQEAHTVSQLKGAPPGYVGYGSGGVLTEAVRRRPYSVVLLDEIEKAHPD
VLEAFYNVFDKGVMEDGTGLVVDFKNTVILATSNVGAELLLDTPSEQTATPTFDERLRKVLLQAFRAAFL
ARMTVVPYRPLEEATLEGIVVAKLEKLRERYKAATGKQFDFDPAIVKAVLAKCSSAGARDIENVLMAEVT
GKLAEWVLG
 
Nucleotide Sequence: 2550 bp     [Download]
>gi|472323176|ref|NC_020829.1|:3364387-3366936 Pseudomonas denitrificans ATCC 13867, complete genome
ATGGACCTCGCCAGCCTGATCGGCCGCCTCAATCCCGAATCCCGCCGCGCCCTGGAGCGCGCCGCGCAGC
GCTGCCTGCAACGCACCCATCACTACGTCGAGATCGAGCACCTGCTGCTGGAACTGCTGGACATCGACGG
CGGCGACCTCGCCCGGCTGCTGCCGCGCTTCGGCCTCGAGCGCGACCAATTGGTGGGCGAGATCAACACC
GCGCTGGAGCTGTTCCGCATCGGCAGCACGCGCACCCCGGCACTCTCCACGCAAACCATCGGCCTGCTGG
AAGACGCGGTGGTGCAGACCAGCGTGCTCGGCCAGCCGACGATCCGCTCCGGGCTGCTGCTGCTCGCCCT
GCTCGACCGCGAGGAACGCCGCGCCCTGCTGCTCAACAGCGCCTCGTCGCTGCTGCGCATTCCCCACGAA
ACGCTGCGGGAAAAACTCCTGGAATGGACCGAAGGCTCCCGCGAACAGCCACCCAGCGCACGCACTCCGG
ACAAGACGAAACCCGCCAACGCGGCGGCCCAGGACAGCGTGCTCGACCAATACACCCAGGACCTCACCGC
CGACGCCCACGCCGGGCGCATCGACCCCATCGTCGGGCGCGACGGCGAGATCCGCCAGTGCGTGGACATC
CTCCTGCGCCGCCGGCAGAACAACCCGATCCTCGTCGGTGCGCCCGGCGTCGGCAAGACCGCCGTAGTGG
AAGGCCTGGCCCTGCGCATCGCCGCCGGGGAAGTGCCACCTCCGCTGCAAGGCGTGATTCTGCGCGTACT
CGACCTCGGCCTGCTGCAGGCCGGCGCCGGGGTCAAGGGCGAGTTCGAGCAGCGCCTGAAAGGCGTGATC
GACGCAGTGCGCAGCAGCGAGCAGCCGATCATCCTGTTCATCGACGAGGCCCACACCCTGATCGGCGCCG
GCGGCGCGGAAGGCGGCAGCGATGCCGCCAACCTGCTCAAGCCGGCCCTGGCCCGTGGCGAGCTGCGCAC
CCTCGCCGCCACCACCTGGCTGGAATACAAGAAGTACTTCGAGAAGGACCCGGCGCTGGCCCGGCGCTTC
CAGCTGGTGCAGGTCGAGGAACCGGACGAGGCCACCGCCGTCGACATGCTGCGCGGTGTGGCCGCCAAGC
TCGAACAGCACCACGGCGTGCAGGTGCTGGACGTGGCCATCCACGACGCGGTGAAGCTCTCGCACCGCTA
CATCTCCGGCCGCCAGTTGCCGGACAAGGCCATCAGCGTGCTGGACACCGCCTGTGCCCGCGTCGCCCTG
GCCCAGCACGATGTCCCGCCGGCACTGGAAAACCTGCGCCACCGCGAACTGGCGGTGGAAGAAGAGCTGC
AACGCCTGCGTCGCGAACAGGCCACCGGCCTGGACCACAGCACGCGCATCACCAGCCTGGAACAGGAATC
GGTGGACAACCTCGCCGCCATCCGCGCCCTGGAAAAACGCTGGGGCGAGGAACGCGAGGCGGTGCGCGAG
CTGCTGCAATCGCGCCGCGAACTACTGACCCTGAGCGAAAGCGCCGACGCCGCCAAGCCCGACGAGGAAC
TCGACGGCCGCATCGATCATCTGGCCGCCGAACTGGCGCGCCTGGAAGCCGGCCTCGACGCCATCCGCGA
GGACGACCCGCTGGTGCCCGAACAGGTCGACTCGAAGACCGTGGCCGCGGTGATCGCCGGCTGGACCGGC
ATCCCGGTGGGCAAGATGCTCGCCGACGAGGCCCACGCCATCCGCACCCTGGCGCAACGCATGAGCCAGC
GGGTGATGGGCCAGGAAGCGGCGCTGGGCACCATCGCCCAGCGCATCCAGGCCTACCGCGCCGGCCTCAC
CGACCCGGCCAAGCCGGTGGGCGTGTTCCTCCTGCTCGGCCCCACCGGCGTGGGCAAGACCGAAACCGCC
TACGCCCTGGCCGACGCCCTCTACGGCGGCGAGCGCAACCTCATCAGCATCAACCTTTCCGAGTACCAGG
AAGCCCACACCGTCAGCCAGCTCAAGGGCGCCCCGCCCGGCTACGTCGGCTACGGCAGCGGCGGCGTGCT
CACCGAGGCCGTGCGCCGCCGGCCCTACTCGGTGGTCCTGCTGGACGAAATCGAGAAGGCCCACCCCGAC
GTGCTGGAAGCCTTCTACAACGTCTTCGACAAGGGCGTGATGGAGGACGGCACCGGCCTGGTGGTGGACT
TCAAGAACACCGTGATCCTCGCCACCAGCAACGTCGGCGCCGAACTGCTGCTGGACACCCCTTCGGAACA
GACCGCTACGCCCACCTTCGACGAACGCCTGCGCAAGGTGCTGCTGCAAGCCTTCCGCGCCGCCTTCCTG
GCGCGCATGACGGTGGTGCCCTACCGGCCGCTGGAGGAAGCGACGCTGGAAGGGATCGTCGTCGCGAAGC
TGGAGAAGCTGCGCGAGCGCTACAAGGCGGCTACCGGCAAGCAATTCGACTTCGACCCGGCGATCGTCAA
GGCGGTGCTCGCCAAGTGCAGTTCGGCGGGGGCGCGGGATATTGAAAATGTGTTGATGGCGGAGGTGACG
GGGAAGTTGGCGGAGTGGGTGCTGGGATAA
 Primer design