SecReT6
Protein ID: 472326145
SecReT6 ID744
T6SS typei4a
Gene symbol-
Locus tagH681_14915
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]3367683..3369689 [+]
Producthypothetical protein
NoteTssI
UniProt IDM4X000
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.50E-72, Aligned region: 30..323
Phage_base_V [PF04717], Evalue: 5.70E-22, Aligned region: 352..444
Gp5_C [PF06715], Evalue: 5.40E-15, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 5.40E-15, Aligned region: 536..557
Gp5_C [PF06715], Evalue: 5.40E-15, Aligned region: 560..583
Gp5_C [PF06715], Evalue: 5.40E-15, Aligned region: 576..595
Gp5_C [PF06715], Evalue: 5.40E-15, Aligned region: 641..654
Protein Sequence: 668 a.a.     [Download]
>gi|472326145|ref|YP_007658391.1| hypothetical protein H681_14915 [Pseudomonas denitrificans ATCC 13867]
MPRPTDTTTSFFLNAPALADLYPQRITGQEALNDLTQLNLLGFSSNPLALPGAIASHLTTTLHNDANQRP
LDALVAEIHQLPADATSDRYQLVLRPWLWWLTLASNNRVFQNLATSDIVTTIFKSHGFTDFKLSLTGSYE
PREYCVQYGESDFAFVSRLLEEEGIFWFFTHEEGKHTLVLADSNDAFPPIPNGPKVPHLGQEIGVRELHG
IRSAQYCLQAVAGTYSATDYEFTTPTTSLYSQAQAEAGPRTQYEHPGGYTAKARGDALTKLRVDGLRSQE
KRLIGESDCRWLVPGHWFTLTGHDDESLNIDWVLISVTHEADHEHYCNRFEAIPKATAYRPPRTTPKPRM
HAQTAKVVGKAGEEIWTDQYGRIKIQFPWDLQGKNDEASSCWVRVVLPWSGKGFGMQFIPRIGQEVIVTF
IDGDPDRPLVTGCVYNGDNALPYALPDNQTQSGIKTNSSKGGGGFNELRFEDKKDAEEVFLQAQKDMKVN
VLNDSAATIGHDETLTVQNARTRTVKEGDETVTLEKGKRSVTIQTGSDTLDVKDTRTVKVGADQTHSTGG
NYSHQVSGNFELTVDGNLTIKVSGTLTLQSGGSLTLKTDADLAAQAGTSLTSKAGTSLTNQAGTSLTNKA
GTSLTNDAGVSLTNKASAEQTVDGGGMLTLKGGLVKVN
 
Nucleotide Sequence: 2007 bp     [Download]
>gi|472323176|ref|NC_020829.1|:3367683-3369689 Pseudomonas denitrificans ATCC 13867, complete genome
ATGCCCCGTCCCACCGATACCACCACCAGCTTCTTCCTGAACGCCCCGGCGCTGGCGGATCTCTACCCGC
AGCGTATTACCGGGCAGGAGGCGCTGAACGATCTCACCCAGTTGAACCTGCTTGGCTTCAGCAGCAATCC
ACTGGCGCTGCCCGGCGCCATAGCCAGCCACCTCACCACCACCCTGCACAACGATGCCAACCAACGCCCC
CTCGACGCCCTGGTCGCCGAAATCCACCAACTCCCCGCCGACGCCACCTCCGACCGCTATCAACTGGTCC
TGCGCCCCTGGCTCTGGTGGCTGACCCTGGCCAGCAACAACCGTGTCTTCCAGAACCTCGCCACCAGCGA
CATCGTCACCACGATCTTCAAGTCCCACGGCTTCACCGACTTCAAGCTGTCGCTGACGGGCAGCTACGAG
CCCCGCGAGTATTGCGTGCAGTACGGCGAAAGTGATTTCGCCTTCGTCTCGCGGCTGCTGGAGGAGGAAG
GCATCTTCTGGTTCTTCACCCACGAAGAGGGCAAGCACACCCTGGTGCTGGCGGACAGCAACGATGCCTT
CCCGCCTATCCCCAACGGGCCGAAGGTGCCGCACCTGGGCCAGGAGATCGGCGTGCGCGAACTGCATGGC
ATTCGCTCCGCGCAGTACTGCCTGCAGGCGGTGGCCGGGACCTACAGCGCCACCGACTACGAGTTCACCA
CGCCCACCACTTCGCTCTACTCGCAAGCCCAGGCAGAAGCCGGGCCACGCACGCAGTACGAGCACCCCGG
CGGCTACACCGCCAAGGCCCGCGGCGATGCGCTGACCAAGCTGCGCGTGGACGGCCTGCGCAGCCAGGAG
AAGCGCCTGATCGGCGAGAGCGACTGCCGCTGGCTGGTGCCGGGGCACTGGTTCACCCTCACCGGGCATG
ACGACGAATCACTGAACATCGACTGGGTGCTCATCTCGGTGACCCACGAGGCCGACCACGAGCACTACTG
CAACCGCTTCGAGGCCATCCCCAAGGCCACTGCCTACCGCCCTCCCCGCACCACGCCCAAGCCGCGCATG
CACGCCCAGACGGCCAAGGTGGTGGGCAAGGCCGGCGAGGAAATCTGGACCGACCAGTACGGCCGCATCA
AGATCCAGTTCCCCTGGGACCTGCAGGGCAAGAACGACGAGGCCTCGTCCTGCTGGGTGCGCGTGGTGCT
GCCGTGGAGCGGCAAGGGCTTCGGCATGCAGTTCATCCCGCGCATCGGCCAGGAGGTGATCGTCACCTTC
ATCGACGGCGACCCGGACCGTCCGCTGGTCACCGGCTGCGTCTACAACGGCGACAACGCCTTGCCCTATG
CGCTGCCGGACAACCAGACGCAGTCGGGTATCAAGACCAATTCCTCGAAAGGTGGCGGCGGCTTCAATGA
ACTGCGCTTCGAGGACAAGAAGGACGCCGAGGAAGTCTTCCTGCAGGCGCAGAAGGACATGAAGGTGAAC
GTGCTCAACGACAGCGCCGCCACCATCGGCCACGACGAGACGCTCACGGTGCAGAACGCCCGCACCCGCA
CGGTGAAGGAAGGCGACGAGACCGTCACCCTGGAAAAGGGCAAGCGCAGCGTGACCATCCAGACCGGCAG
CGACACGCTGGACGTGAAGGACACCCGCACGGTGAAGGTCGGCGCCGACCAGACCCACAGCACCGGCGGC
AACTACAGCCACCAGGTCAGCGGCAACTTCGAGCTGACGGTGGATGGCAACCTCACCATCAAGGTCAGCG
GCACCCTCACCCTGCAGAGCGGCGGCAGCCTGACGCTCAAGACCGACGCCGATCTTGCCGCCCAGGCCGG
CACCTCGCTGACCAGCAAGGCCGGAACGTCACTCACCAACCAGGCGGGCACCTCCCTGACCAACAAGGCC
GGCACCTCCCTGACCAACGACGCCGGCGTCAGCCTCACCAACAAGGCCAGTGCCGAGCAGACGGTGGACG
GCGGCGGCATGCTGACCCTCAAGGGCGGCCTGGTGAAGGTCAACTGA
 Primer design