SecReT6
Protein ID: 473827769
SecReT6 ID745
T6SS typei5
Gene symbol-
Locus tagTOL_0370
StrainThalassolituus oleivorans MIL-1
Repliconchromosome [GenBank: NC_020888] [Browse all T6SS(s) in this replicon]
Location [Strand]397969..401466 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDM5DNT1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 5.90E-93, Aligned region: 72..115
ImcF-related_N [PF14331], Evalue: 5.90E-93, Aligned region: 197..458
IcmF-related [PF06761], Evalue: 5.30E-62, Aligned region: 508..808
DUF1215 [PF06744], Evalue: 4.70E-29, Aligned region: 350..366
DUF1215 [PF06744], Evalue: 4.70E-29, Aligned region: 905..1027
Protein Sequence: 1165 a.a.     [Download]
>gi|473827769|ref|YP_007681052.1| type VI secretion protein IcmF [Thalassolituus oleivorans MIL-1]
MKRLLEFLTNKWVLGIIGLTALSLLIWFGAEFIKFGSDNVTLSTTTRWIIISLFWLIWLTWNMAQWLVER
RQNKELIGSIEESQEEAKNPDDERSQEELTAMSQRFREALATLKKTRFKSRFGSRSLYQLPWYIIIGPPG
AGKTTALINSGLNFPLAESHGKQALGGVGGTRNCDWWFTNDAVLIDTAGRYTTQDSHRVVDNNAWNAFLT
LLKKYRRRRPINGALVAISLQDLMVQTAEQRNQQAKTIKTRIGELQEELGVRFPVYLTFTKCDLVAGFAE
FFANLSQSEREQVWGVSFPAETSPETGADIGRFKAEFAELAKRLNGMLLGRVHQERNIEKRSMIQSFPAH
FESLGGVVDEFVAQVFSPDRFGSVPMLRGVYFTSATQEGSPIDRMMAQVSNNFGLERNMGKQQQNSGKSF
FITRLFNDVIFPESELVGVNRKVENILLWLRRGTLAVFSLIFLGSAALWAGGLTKNKSFMTDVDALFYDF
KQQAEKFDVTRDDIPAVLPVMNPLLNASLVYDQDEHPFLSNLGLYDGRVDSSADALYQVELNKIFFPAVK
TMLERHLNTLTYTDSELLPIFKVYLMLFDEEHRDYQQIRAYAKTRWQDMLPGEAGKQEQLLRHLDNLFGA
PLNTEVVANDQVVERTRLQLKRIPVAQRLYAQLQNSGNNAQLVDLYREIGGDTQQAFGIAETDPVFKMPF
LFTKAGFKNAEYGANSDMMTKIAEDRWIYGDGANGEDFTKADLEKLSDEVEKLYLSEYAKRWQAFYQRFT
LARITNSIQAIAVLQQLSDPIASPLVHVSELVAENTSLTPQVSLDPNKGAVAGAAAKVFSKVYEPNIVDL
RFQDVQRMVKSENGVPSKMQSYLLGIQQLNEYFRQINSAPDSNAAAFDVAKAKFTANGADAMQQLKSLAA
TAPEQAQGWLNHLANSTWTLIVGKAKTHIDTVWRYQVYDNYRENIYNRYPMSADKKSEATVIAFDEFFKP
GGIQQSFVDEYVLPFVDTRRWQAKSYDGLTLGISNSSLAQFRRADNIRKAFYAKGESAGFAFAVEPHKLD
SNVRLFTLEVGDSRMSYSHGPRIEKDVMWSAAESNRSRVVFEDLNEAVSSKQFDGDWSFLRLLDDADMKA
TSNAREYSVTFTGNGHNAVYNLIAPSSVNAFDFGLLRNFSCPQSL
 
Nucleotide Sequence: 3498 bp     [Download]
>gi|473827406|ref|NC_020888.1|:397969-401466 Thalassolituus oleivorans MIL-1 complete genome
ATGAAACGTCTACTTGAGTTTCTAACAAATAAGTGGGTCTTAGGCATCATAGGCCTTACAGCTCTATCTT
TGCTGATTTGGTTTGGCGCTGAATTCATCAAGTTTGGTAGCGATAACGTTACCCTAAGCACAACGACTCG
TTGGATCATTATCAGCCTATTTTGGTTGATTTGGTTAACCTGGAATATGGCGCAATGGTTAGTTGAGCGT
CGTCAAAATAAAGAGTTGATCGGTAGCATTGAAGAGTCTCAAGAAGAAGCAAAAAACCCAGACGATGAGC
GTAGCCAAGAAGAATTAACGGCTATGTCGCAGCGCTTCAGGGAGGCGCTGGCGACGCTGAAAAAAACTCG
CTTTAAATCTCGCTTTGGTAGTCGAAGCTTATACCAGCTACCTTGGTACATTATTATTGGGCCGCCGGGT
GCAGGTAAAACCACGGCATTAATCAATTCCGGTCTTAATTTTCCGCTTGCTGAGAGTCACGGTAAACAAG
CGCTTGGCGGTGTTGGCGGTACGCGTAATTGTGATTGGTGGTTTACTAATGATGCTGTGTTAATTGATAC
CGCGGGTCGTTACACCACGCAAGATAGCCATCGCGTTGTCGACAATAATGCGTGGAATGCATTTTTAACC
CTTTTGAAAAAATACCGCCGTCGTCGTCCGATTAATGGTGCTTTGGTTGCTATTAGTTTGCAGGACTTAA
TGGTTCAGACTGCGGAACAGCGCAATCAACAAGCGAAGACGATTAAAACGCGTATTGGCGAATTGCAGGA
AGAATTAGGCGTTCGTTTCCCCGTTTATTTGACCTTCACTAAGTGTGATTTAGTGGCAGGTTTTGCCGAG
TTTTTTGCTAATTTGTCGCAATCCGAGCGTGAGCAGGTTTGGGGGGTAAGTTTCCCTGCGGAAACCAGTC
CAGAGACCGGAGCTGATATTGGTCGCTTTAAAGCTGAATTTGCCGAGTTGGCGAAACGCTTAAACGGCAT
GCTGCTAGGGCGAGTTCATCAAGAGCGTAATATCGAAAAACGTTCAATGATTCAAAGCTTCCCTGCGCAT
TTTGAAAGTCTTGGTGGTGTTGTTGATGAGTTTGTCGCTCAGGTTTTCTCACCCGACCGTTTTGGTTCAG
TGCCTATGCTGCGTGGTGTGTATTTTACCAGTGCCACCCAAGAAGGTAGTCCGATTGATCGCATGATGGC
TCAGGTGAGTAATAACTTTGGCCTTGAGCGCAATATGGGCAAGCAGCAGCAAAATAGCGGTAAGAGCTTT
TTTATAACGCGCTTGTTTAATGACGTTATTTTCCCTGAATCGGAGCTCGTGGGTGTTAATCGCAAAGTTG
AGAATATTTTACTTTGGCTAAGGCGGGGCACACTTGCGGTATTTTCTTTGATCTTCTTAGGCAGTGCAGC
GCTGTGGGCTGGAGGTCTTACTAAAAATAAATCGTTCATGACGGATGTTGATGCGCTGTTTTATGACTTC
AAGCAGCAGGCTGAAAAGTTTGACGTAACGCGGGACGATATCCCTGCGGTATTACCGGTAATGAATCCTT
TGCTAAATGCCAGCTTGGTATACGATCAGGATGAACATCCATTCCTAAGCAACCTTGGCCTTTATGATGG
CCGTGTTGATTCATCGGCAGATGCTTTATATCAAGTTGAATTGAATAAGATATTTTTCCCTGCGGTTAAA
ACCATGTTGGAAAGACATCTAAACACACTGACCTATACCGATAGTGAACTGCTGCCAATATTTAAAGTGT
ATTTAATGTTGTTTGACGAAGAGCATCGCGATTATCAGCAGATTCGCGCGTATGCTAAAACTCGTTGGCA
GGATATGTTGCCGGGCGAAGCCGGTAAGCAGGAGCAGTTGTTACGCCATTTGGATAACTTATTCGGCGCG
CCTTTAAATACTGAGGTTGTTGCTAACGATCAAGTGGTTGAGCGTACGCGTTTGCAGTTAAAGCGTATTC
CCGTTGCGCAGCGTTTATATGCGCAATTGCAGAATAGCGGTAACAATGCTCAGCTTGTTGATCTATACCG
CGAAATCGGTGGCGACACACAACAAGCGTTCGGCATTGCAGAAACCGATCCTGTTTTCAAAATGCCATTT
TTGTTTACTAAAGCCGGCTTTAAGAATGCTGAGTACGGCGCTAACTCTGACATGATGACCAAGATCGCGG
AAGATCGTTGGATTTATGGTGATGGCGCAAATGGCGAAGATTTCACTAAAGCAGATTTAGAGAAATTAAG
TGACGAAGTTGAAAAATTATATTTAAGCGAATATGCCAAGCGTTGGCAGGCGTTCTATCAGCGTTTTACC
TTGGCACGTATTACTAACAGCATTCAAGCGATTGCCGTATTGCAGCAGTTATCCGATCCGATTGCATCGC
CATTAGTGCATGTGAGCGAGCTTGTTGCTGAAAATACTAGCTTAACGCCGCAAGTATCGCTCGATCCAAA
CAAAGGCGCTGTCGCTGGGGCCGCTGCAAAAGTGTTCTCTAAAGTATACGAGCCCAATATCGTCGATCTT
AGATTTCAAGATGTTCAGCGTATGGTGAAAAGCGAGAACGGCGTACCGTCGAAAATGCAATCGTATTTGC
TGGGCATTCAGCAGTTAAACGAGTACTTCCGACAAATTAACAGTGCCCCTGATTCTAATGCCGCGGCTTT
TGATGTAGCGAAAGCTAAGTTTACCGCTAACGGTGCTGATGCTATGCAGCAATTGAAGAGTCTTGCCGCG
ACAGCACCAGAACAAGCGCAAGGGTGGTTGAATCATTTAGCAAATTCAACATGGACGTTAATTGTCGGCA
AGGCGAAAACTCACATAGATACCGTTTGGCGTTATCAGGTTTATGATAATTATCGCGAAAATATCTATAA
CCGTTATCCAATGTCGGCGGATAAAAAATCCGAAGCGACAGTGATCGCTTTCGATGAATTCTTTAAGCCG
GGTGGCATACAGCAAAGCTTTGTTGACGAATATGTGTTGCCATTTGTTGATACGCGTCGTTGGCAGGCGA
AAAGCTACGATGGCTTAACCTTAGGTATCAGCAATTCATCACTTGCGCAGTTCCGCCGCGCCGACAATAT
TCGTAAGGCCTTTTATGCCAAGGGAGAAAGTGCTGGTTTCGCATTTGCGGTAGAGCCGCATAAGCTGGAC
TCTAATGTGCGTCTATTTACGCTCGAAGTGGGAGATTCTCGGATGTCTTATTCCCATGGTCCGCGCATTG
AAAAAGATGTGATGTGGAGCGCTGCAGAAAGTAACCGTTCGCGCGTTGTCTTTGAAGATTTAAACGAAGC
GGTAAGCAGTAAGCAATTTGATGGCGATTGGTCATTCCTAAGATTGCTTGATGATGCCGATATGAAAGCG
ACCAGTAATGCCCGTGAATATTCCGTAACGTTTACGGGTAATGGCCATAATGCGGTTTACAACTTAATTG
CTCCGAGTAGTGTTAATGCCTTTGATTTTGGCTTGCTAAGAAACTTTAGCTGCCCTCAGTCGTTATAA
 Primer design