SecReT6
Protein ID: 478478841
SecReT6 ID747
T6SS typei4a
Gene symbol-
Locus tagG655_13245
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]2907509..2911324 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDM9S612
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.00E-34, Aligned region: 114..354
Protein Sequence: 1271 a.a.     [Download]
>gi|478478841|ref|YP_007709492.1| type VI secretion protein IcmF [Pseudomonas aeruginosa B136-33]
MSGATLFMLVLLLVLLALLLGALGWWWRTRGGTEIRSFYAAVRQMEREQGWQGRYEAPWLLMLGNETEGE
QLCATWRLLPVARPAWFGRWWSDGEGAILLVPESVFLPDEGLRRQSGAWLRLLRLFLRLRGRRALDGVVW
NIPLARLQDGEQAANLGLAARRRYVELTQRLGLSLPVYVVITGLEDLPGFQELLAALPEEARERALGWSS
PFAAEAAWQSRWCEQALEEITATLTESIVELGTLRGQVNNDLYCLPPRLESLRGSLQALLEPVFQGNARG
EAPRFRGLYLSGSEAAGAASDEALPAVDAPRRRSSFASQLWARRILAEEGLAQAVPRILQLRQRWQRGIG
LAALCLCLLWGGLMTWVWRDALRDAGELSQLLHGASERYQPLDDDTRRAAQVRQNVQAWWQLVAQAPRWR
FTSLAFPSSWFSSLDARIDSAYRRVSERLLVRPLRSLLEGEASDLRAIRSDGQPGLKEGDDPSQWKDYLA
AKDLVARATTLERHNRLFAQAIDNRKTPLDDLLQLSNDALGSSYNAGSLARLAYYNRTLFAERPADLAAL
DLGRVGATAADNFHDLMARWLNAYFLTDSLERTGNALTQELAQLGQERDATAAQLLGVGELINHLQQQVN
RINLIWGNGVGQDLVPGYQNLLKSAQQSSLLGDRVEELQNLTVQLQQQFRSEWIAPPEAAGDGLLVKQGA
ALKLADDLLGLKRAIDDLKTKDFVSVALAGKTLAEHSLLSIDDIGVTQALSFFNDFSGYYESTLPSLNPR
YRYSVLHAAASATTEAMWQSLGPRSRSLTSRNASRFDVQVKQVQALQAALLELQDMQAGARLLASLNALA
VADIGQALRDIDEQAVLREPVDFSRWSGAPNFGLQAFRAQDSAELKQSLTSQFNAMAAVAERHAPALEWL
QAQQSSLATADYNAFVRFSALNAELQKFKADNPASTAAQLAKLVGNDFNQMDIGSCADILNGVLLPSSRS
DLATRLVDLRQGALGRCQSLQQQQAAQAWKDLADYFNQYLAGRFPFAYSLEAADAEPGRVRHLLKLMETR
LPQVREGLAQVRSPDLPAAEDFVRRLEQAQGWLGPLFERDKSGLLGVALDIDWRSDRSLERGADQVIAWS
LYSGDQESRFPGAQDKGLTWNVGDPLKIMLRWAKNGSQRPADDPRQASLAVADLEAGWSYQGSWALLRMM
RAHFSRQRPPNVDYTEFPLVLQLPVYAPYSPENEARMFLRLSLMSLGGKTPLSIQPLPVRAPQSPFATLL
PATVASTGGTP
 
Nucleotide Sequence: 3816 bp     [Download]
>gi|478476202|ref|NC_020912.1|:2907509-2911324 Pseudomonas aeruginosa B136-33, complete genome
ATGAGCGGCGCGACGCTGTTCATGCTGGTTCTCCTCCTGGTGCTGCTGGCGCTGCTGCTGGGGGCGCTGG
GCTGGTGGTGGCGGACCCGGGGCGGTACGGAGATCCGCAGCTTCTACGCGGCGGTCCGGCAGATGGAGCG
CGAGCAGGGCTGGCAGGGCCGCTACGAAGCGCCGTGGCTGCTGATGCTCGGCAACGAGACCGAGGGCGAG
CAGTTGTGCGCCACCTGGCGCCTGCTGCCGGTGGCGCGTCCGGCCTGGTTCGGCCGCTGGTGGTCGGACG
GCGAGGGGGCGATCCTGCTGGTGCCCGAGTCGGTGTTCCTGCCCGACGAGGGCCTGCGCCGGCAAAGCGG
CGCCTGGCTGCGCCTGTTGCGTCTGTTCCTGCGCCTGCGCGGCAGGCGCGCGCTGGACGGAGTGGTCTGG
AACATTCCGCTGGCGCGGCTGCAGGATGGCGAGCAGGCGGCCAACCTCGGCCTCGCCGCCCGTCGTCGCT
ACGTGGAACTGACCCAGCGCCTTGGCCTGAGCCTGCCGGTGTACGTGGTGATCACTGGCCTGGAAGACCT
GCCGGGTTTCCAGGAACTTCTCGCGGCGCTGCCCGAGGAGGCGCGCGAGCGCGCCCTCGGCTGGTCCTCG
CCGTTCGCCGCCGAGGCGGCCTGGCAGTCGCGCTGGTGCGAGCAGGCGCTGGAGGAAATCACCGCCACCC
TGACCGAGTCGATCGTCGAACTCGGTACCTTGCGCGGCCAGGTGAACAACGACCTGTATTGCCTGCCGCC
ACGCCTGGAAAGCCTCCGCGGTTCGTTGCAGGCGCTGCTCGAACCGGTCTTCCAGGGCAACGCCAGGGGC
GAGGCGCCGCGCTTTCGCGGTCTCTACCTGAGCGGCAGCGAGGCGGCGGGGGCGGCAAGCGACGAAGCCC
TGCCGGCGGTCGACGCGCCGCGTCGGCGCAGCAGCTTCGCCAGCCAACTGTGGGCACGGCGGATCCTTGC
CGAGGAAGGCCTGGCCCAGGCGGTGCCGCGCATCCTCCAGCTGCGCCAGCGCTGGCAGCGCGGTATCGGC
CTCGCCGCGCTGTGCCTGTGCCTGCTCTGGGGCGGCTTGATGACCTGGGTCTGGCGTGACGCGCTGCGCG
ACGCCGGCGAACTGTCGCAACTGCTGCATGGCGCCAGCGAGCGCTACCAGCCGCTCGACGACGACACCCG
GCGCGCCGCCCAGGTCCGGCAGAACGTCCAGGCCTGGTGGCAACTGGTGGCACAGGCGCCGCGCTGGCGC
TTCACCTCGCTGGCGTTCCCCAGTTCCTGGTTTTCCTCCCTGGACGCACGTATCGACAGCGCGTATCGCC
GCGTTTCCGAGCGCCTGCTGGTGCGCCCGCTGCGCAGCCTGCTGGAAGGCGAGGCGAGCGACCTGCGGGC
GATCCGCAGCGACGGCCAGCCCGGCCTGAAGGAGGGCGACGACCCCAGCCAGTGGAAGGACTACCTGGCG
GCGAAGGACCTGGTCGCCCGCGCCACTACGCTGGAGCGCCACAATCGCCTGTTCGCCCAGGCCATCGACA
ACCGCAAGACGCCGCTCGACGATCTCCTGCAACTGAGCAACGACGCCCTGGGCAGCAGCTACAACGCCGG
CAGCCTGGCGCGCCTGGCCTACTACAACCGCACGCTGTTCGCCGAGCGTCCGGCCGATCTCGCCGCCCTC
GACCTGGGCCGGGTCGGCGCCACGGCGGCGGATAACTTCCATGACCTGATGGCACGCTGGCTGAACGCCT
ACTTTCTCACCGACAGCCTGGAACGCACCGGCAATGCCCTGACCCAGGAACTCGCGCAGCTCGGCCAGGA
ACGAGATGCCACGGCGGCCCAGTTGCTGGGGGTCGGCGAATTGATCAACCACCTGCAGCAGCAGGTCAAC
CGCATCAACCTGATCTGGGGCAATGGCGTCGGCCAGGATCTCGTCCCTGGCTACCAGAACCTGCTCAAGA
GCGCCCAGCAAAGCAGCCTGCTGGGAGACCGCGTGGAGGAACTGCAGAACCTCACGGTGCAGTTGCAGCA
GCAGTTCCGCAGCGAATGGATCGCACCTCCGGAGGCTGCCGGCGACGGCCTGCTGGTGAAGCAGGGGGCG
GCCCTCAAGCTGGCCGATGACCTGCTCGGCCTGAAACGCGCCATCGATGACCTGAAGACCAAGGACTTCG
TCTCCGTGGCCCTGGCCGGCAAGACGCTGGCGGAGCACTCCCTGCTGAGCATCGACGACATCGGCGTGAC
CCAGGCGTTGAGCTTCTTCAACGACTTCAGCGGCTACTACGAGAGCACCCTGCCGTCGCTCAACCCGCGC
TATCGCTACTCGGTCCTGCACGCCGCCGCCAGCGCGACGACCGAGGCCATGTGGCAAAGCCTCGGGCCGC
GCAGTCGCAGCCTGACCAGCCGCAATGCCTCGCGCTTCGACGTGCAGGTCAAGCAGGTCCAGGCATTGCA
GGCGGCGCTGCTGGAGTTGCAGGACATGCAGGCCGGCGCGCGCCTGCTGGCCAGCCTCAACGCGCTGGCC
GTGGCCGATATCGGCCAGGCCCTGCGCGACATCGACGAGCAGGCGGTGCTGCGCGAGCCGGTCGATTTCA
GTCGCTGGTCGGGCGCGCCGAATTTCGGCCTGCAGGCGTTCCGCGCCCAGGACAGCGCCGAGCTGAAGCA
GAGCCTGACCAGCCAGTTCAATGCCATGGCCGCGGTCGCCGAGCGCCACGCCCCGGCGCTGGAGTGGCTG
CAGGCGCAGCAGTCCAGCCTGGCCACCGCCGACTACAACGCGTTCGTGCGCTTCAGCGCGCTCAACGCCG
AACTGCAGAAATTCAAGGCCGACAACCCGGCGAGCACCGCGGCGCAGCTGGCGAAGCTGGTGGGCAACGA
TTTCAACCAGATGGACATCGGCAGTTGCGCCGACATTCTCAACGGCGTGCTCCTGCCGTCCAGCCGCAGC
GACCTGGCGACGCGCCTGGTGGACCTGCGCCAGGGCGCGCTCGGGCGCTGCCAGTCGTTGCAACAGCAGC
AGGCGGCGCAGGCCTGGAAGGACCTCGCCGACTACTTCAACCAGTACCTCGCCGGACGCTTCCCCTTCGC
CTACAGCCTGGAAGCGGCCGATGCCGAGCCGGGGCGGGTGCGGCACCTGCTGAAGCTGATGGAGACGCGC
TTGCCGCAGGTGCGCGAAGGGCTGGCCCAGGTTCGCTCGCCGGACCTGCCGGCCGCCGAGGACTTCGTCC
GCCGCCTGGAACAGGCGCAGGGCTGGCTCGGCCCGCTGTTCGAGCGCGACAAGTCGGGCCTGCTCGGCGT
CGCCCTGGACATCGACTGGCGCAGCGACCGCAGCCTGGAACGCGGCGCCGACCAGGTGATCGCCTGGAGC
CTGTACTCGGGCGACCAGGAAAGCCGGTTCCCCGGCGCGCAGGACAAGGGCCTGACCTGGAACGTCGGCG
ATCCGCTGAAGATCATGCTGCGTTGGGCGAAGAACGGCTCGCAGCGCCCGGCAGACGACCCGCGCCAGGC
CAGCCTGGCGGTTGCCGACCTCGAGGCCGGCTGGAGCTACCAGGGCTCCTGGGCGCTGCTGCGCATGATG
CGTGCGCACTTCTCCCGGCAGCGCCCGCCGAACGTCGACTACACGGAGTTTCCGCTGGTCCTGCAACTGC
CGGTGTATGCGCCCTACAGCCCGGAAAACGAGGCGCGGATGTTCCTCCGCCTGTCGTTGATGAGCCTGGG
CGGCAAGACCCCGCTGTCCATCCAGCCGCTGCCGGTGCGCGCGCCGCAATCGCCGTTCGCGACGCTGTTG
CCGGCCACCGTCGCCAGCACCGGAGGTACCCCATGA
 Primer design