SecReT6
Protein ID: 478479555
SecReT6 ID748
T6SS typei1
Gene symbol-
Locus tagG655_16830
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]3708169..3709158 [-]
Productserine-threonine kinase Stk1
NoteStk1
UniProt IDM9S9Y7
KEGG IDpsg:G655_16830
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 4.30E-41, Aligned region: 51..286
Pkinase_Tyr [PF07714], Evalue: 7.10E-26, Aligned region: 53..306
APH [PF01636], Evalue: 6.10E-05, Aligned region: 97..176
APH [PF01636], Evalue: 6.10E-05, Aligned region: 164..203
APH [PF01636], Evalue: 6.10E-05, Aligned region: 228..305
RIO1 [PF01163], Evalue: 0.0046, Aligned region: 128..202
Protein Sequence: 329 a.a.     [Download]
>gi|478479555|ref|YP_007710206.1| serine-threonine kinase Stk1 [Pseudomonas aeruginosa B136-33]
MNEPLSSLELLPEEEGGANLTYFAFAAPTASAPDLPAVLPGPLPDVLSGRYRLERMLGAGGMGTVYRARD
LLHEQFGDPAPLVALKLLNESVAESPDASALLYSEFALTRRLRHPNVVRLFTFDVDTACQRAYIVMELMP
GLPLDRLLCERPEGLPWSELSAIARPLLDALAYVHEQGVLHGDLKPSNVMLGEEGVRLFDFGLGQAQAGI
LDGLPQLSRGRIDAWTPGYAAPELLEGAPLSPAADLYALACVLYELADGRHPFRRLPSNQAREQGLERQL
RAPGHLPRRCWPALRTALSLDPERRCIGVRELQEALGARRSWLAGVLAR
 
Nucleotide Sequence: 990 bp     [Download]
>gi|478476202|ref|NC_020912.1|:c3709158-3708169 Pseudomonas aeruginosa B136-33, complete genome
ATGAACGAACCGCTGTCGTCGCTGGAGCTGCTGCCGGAGGAGGAGGGCGGCGCGAACCTGACCTATTTCG
CCTTCGCCGCCCCGACCGCCTCGGCGCCGGACCTGCCGGCGGTGTTGCCCGGTCCGCTGCCGGACGTTCT
TTCCGGGCGCTACCGTCTGGAGCGGATGCTCGGCGCCGGCGGCATGGGCACGGTATACCGTGCCCGGGAC
CTGCTCCATGAGCAGTTCGGCGACCCGGCGCCGCTGGTAGCGTTGAAGCTGCTCAACGAATCGGTCGCCG
AGTCACCCGACGCCAGCGCCTTGCTCTATAGCGAGTTCGCCCTGACCCGGCGCTTGCGCCATCCGAACGT
CGTGCGTCTGTTCACCTTCGACGTCGACACCGCCTGCCAGCGCGCCTACATCGTCATGGAACTCATGCCT
GGCCTGCCGCTCGATCGCCTGCTCTGCGAGCGTCCCGAAGGCCTGCCCTGGTCCGAGTTGAGCGCGATCG
CCCGGCCGTTGCTGGACGCCCTGGCCTATGTCCACGAACAAGGGGTGCTGCATGGCGACCTGAAGCCGAG
CAACGTGATGCTCGGCGAGGAGGGCGTGCGGCTCTTCGACTTCGGCCTCGGCCAGGCGCAGGCAGGCATC
CTGGACGGCCTGCCGCAGCTCAGCCGGGGCCGCATCGACGCCTGGACCCCGGGCTACGCCGCTCCCGAAC
TGCTCGAGGGTGCGCCGTTGTCGCCGGCAGCCGACCTGTATGCGCTGGCCTGCGTCCTCTACGAACTGGC
CGACGGTCGCCATCCGTTCCGCCGCCTGCCCTCGAACCAGGCCCGGGAGCAGGGGCTGGAGCGCCAGCTG
CGCGCGCCCGGACACCTGCCTCGGCGCTGCTGGCCGGCGCTGCGTACCGCCCTGAGCCTCGACCCCGAAC
GGCGCTGCATCGGCGTCCGCGAATTGCAGGAAGCGCTGGGCGCGCGGCGTTCCTGGCTGGCCGGCGTTCT
TGCCCGTTGA
 Primer design