SecReT6
Protein ID: 478479557
SecReT6 ID748
T6SS typei1
Gene symbol-
Locus tagG655_16840
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]3709883..3713410 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDM9S394
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.20E-76, Aligned region: 255..273
IcmF-related [PF06761], Evalue: 3.20E-76, Aligned region: 502..792
IcmF-related [PF06761], Evalue: 3.20E-76, Aligned region: 948..996
ImcF-related_N [PF14331], Evalue: 7.00E-75, Aligned region: 196..453
DUF1215 [PF06744], Evalue: 4.20E-34, Aligned region: 910..1034
Protein Sequence: 1175 a.a.     [Download]
>gi|478479557|ref|YP_007710208.1| type VI secretion protein IcmF [Pseudomonas aeruginosa B136-33]
MKNFFKKVGAFLRKTWVWTLLLVLLAALLVWFVGPLLAVADYKFWESPTSRLLSISLMFLVWGLAMVFVS
WRAGVRRKAVEDSDEGQERLRRDGLIEDEQKELRSRFKDALRTLKTSSLYRGRSERWRNELPWYLLIGPQ
GSGKTSLLDFSGLEFPINRIDRKLTRDTAGTRYCDWYFADHGVLIDTAGRYLTQADGEVDGGAWATLLGL
LRKRRRARPLNGVMVSIPVETLLSDDEMALDTLARQVRARLQEIQQTLHLDLPVYLVLSKADQLLGFDEF
FDQLSREESDQVLGTSFGKEQNGTDVTVLRQAFEDLLRRLNSQVIMRIHQERDTLRRGRILDFPHQLGQI
GERLCLFVELAFTGNRYQRASRLRGFYLTSAPHLAQQLDEDTAGIGANLGIASGLLPTLRNGRSRFIHHL
LSQVIFPEANLAGLDRRERTRIHWGQRALYVGSLALLLLFGLLWAGGFSANHERLERVRELAQQWAQQRQ
ALGERDDAMAALKTLDSSYAATTVFPPKGEVSLHERAGLYQGNEVNPPLAAAYRRELETQLLPRVARMLE
AQIRGNMQNRERLLNSLRAYLMLNLRERRENGWLKDWVATEWSQRYAGNGTVQNGLNTHFARLLEQPFSY
PLNDTLVAQARQVLRSESLANVVYRVLREQARSLPEYRFGQHLGPQASLFVGTDYVIPGFYTQQGYQQYF
VVQGASLVNDILRDNWVLGEGSGISDMDLRRLMVELEQLYFRDYANFWSEAVGRLGLLPFNDAGEGADQV
SGLLAANSPILQLLLEVRENTRFPVLAESAEALAEASDKAAEKGGKLGKAAAAAAGKARDALAKNLPDTA
KKSLQRRFEPLHRLLDDNNGPAADLTPLLQALNELQLQLAGLARASQPEQAAFDMAKSRMGGQRDALSNL
RNASARLPRPLGGWFSVLAEDAWRLVLGDAYLYLNQRYQSELYGFYSKAINKRYPFNAHSASDVAVSDFR
EFFKAQGVAERFFETYMRPFVSGDPGSYRLRSVDGYSLPMSKVYLDQMGTAQVIRQSFFAENPAEPQVRF
RLEPYTLDPGVSRAEFRFDGQSMEYRHGPIVPMSFKWPSDADGGRTSLVLEKMAGRPVGIERNTGPWSLF
RLFDLMQTEYLSGRDVMVLKADLGGLRANYLLLAQRTPNPFDLAVLRSFRMPVQL
 
Nucleotide Sequence: 3528 bp     [Download]
>gi|478476202|ref|NC_020912.1|:c3713410-3709883 Pseudomonas aeruginosa B136-33, complete genome
ATGAAAAACTTCTTCAAGAAAGTCGGCGCCTTCCTGCGCAAGACGTGGGTCTGGACGCTGCTGCTGGTAC
TCCTGGCGGCATTGCTGGTGTGGTTCGTCGGGCCGCTGCTGGCGGTCGCCGACTACAAGTTCTGGGAAAG
CCCGACCTCGCGGTTGCTGAGCATCAGCCTGATGTTCCTGGTCTGGGGGCTGGCGATGGTCTTCGTCAGC
TGGCGCGCCGGAGTGCGGCGCAAGGCCGTCGAGGACAGCGACGAGGGCCAGGAGCGCCTGCGCCGCGACG
GTCTGATCGAAGACGAACAGAAGGAATTGCGCAGCCGCTTCAAGGACGCCTTGCGCACCCTGAAGACCTC
CAGCCTGTACCGCGGTCGTAGCGAGCGCTGGCGCAACGAGCTGCCCTGGTACCTGCTGATCGGCCCGCAG
GGAAGCGGCAAGACCAGCCTGCTGGACTTTTCCGGACTGGAGTTCCCGATCAACCGGATCGACCGCAAGC
TGACCCGCGATACCGCCGGCACGCGCTACTGCGACTGGTACTTCGCCGACCACGGCGTCCTGATCGACAC
CGCCGGGCGCTACCTGACCCAAGCCGACGGCGAGGTCGACGGGGGCGCCTGGGCGACCCTGCTCGGCCTG
TTGCGCAAGCGCCGCCGCGCACGGCCGCTGAATGGCGTGATGGTGTCGATTCCGGTGGAGACGTTGCTCA
GCGACGACGAGATGGCGCTGGATACGCTGGCTCGCCAGGTGCGCGCGCGCCTGCAGGAAATCCAGCAGAC
CCTGCACCTCGATCTGCCGGTCTACCTGGTGCTGAGCAAGGCCGACCAGTTGCTCGGCTTCGACGAGTTC
TTCGACCAGTTGAGCCGCGAGGAGAGCGACCAGGTTCTGGGCACCAGCTTCGGCAAGGAGCAGAACGGCA
CCGATGTGACGGTCCTGCGCCAGGCGTTCGAGGACCTTCTGCGACGCCTGAACAGCCAGGTGATCATGCG
CATCCACCAGGAGCGCGATACCCTGCGTCGCGGTCGCATCCTCGACTTCCCGCACCAGCTTGGCCAGATC
GGCGAGCGGTTGTGCCTGTTCGTCGAACTCGCCTTCACCGGCAACCGCTACCAGCGCGCCAGCCGCCTGC
GCGGCTTCTACCTGACCAGTGCGCCGCACCTGGCCCAGCAGCTGGATGAGGACACCGCCGGCATCGGCGC
CAACCTGGGGATCGCCAGCGGCCTGCTGCCGACCCTGCGCAACGGGCGCTCGCGCTTCATCCACCACCTG
CTGAGCCAGGTGATCTTCCCTGAGGCCAACCTGGCAGGTCTCGATCGCCGCGAACGCACGCGCATCCACT
GGGGCCAGCGCGCCCTGTACGTCGGTTCGCTGGCGCTCCTTCTGCTATTCGGCCTGCTCTGGGCTGGCGG
TTTCTCGGCCAACCACGAGCGCCTGGAGCGGGTCCGCGAGCTGGCGCAGCAATGGGCCCAGCAGCGCCAG
GCGCTTGGCGAGCGCGACGACGCCATGGCGGCGCTGAAGACGCTGGATAGCAGCTATGCGGCGACCACCG
TGTTTCCGCCCAAAGGGGAAGTCTCGCTGCACGAGCGCGCCGGGCTGTACCAGGGCAACGAGGTCAACCC
GCCGCTGGCCGCTGCCTATCGCCGCGAGCTGGAGACGCAACTGCTGCCGCGCGTGGCGCGGATGCTCGAA
GCGCAGATCCGCGGCAACATGCAGAATCGCGAACGCCTGCTCAACAGCCTGCGGGCCTACCTGATGCTGA
ATCTGCGCGAGCGCCGCGAGAACGGATGGCTCAAGGACTGGGTGGCTACCGAATGGTCGCAGCGCTATGC
CGGCAACGGCACCGTGCAGAATGGCCTGAACACGCATTTCGCCCGTCTGCTCGAGCAACCGTTCAGCTAT
CCGCTGAACGACACCCTGGTGGCCCAGGCGCGCCAGGTGCTGCGCAGCGAGTCCCTGGCCAACGTGGTCT
ACCGGGTGCTGCGCGAACAGGCGCGAAGCCTGCCCGAGTATCGCTTCGGCCAGCACCTGGGGCCGCAGGC
CAGTCTGTTCGTCGGCACCGACTACGTGATCCCGGGGTTCTACACCCAGCAGGGCTACCAGCAGTACTTC
GTGGTCCAGGGCGCCAGCCTGGTCAACGACATCCTTCGCGACAACTGGGTCCTGGGCGAGGGCAGCGGGA
TCAGCGACATGGACCTGCGGCGTCTGATGGTCGAACTCGAGCAGTTGTATTTCCGCGACTACGCGAACTT
CTGGAGCGAGGCGGTCGGACGCCTGGGCCTGCTGCCGTTCAACGATGCCGGCGAGGGCGCCGACCAGGTT
TCCGGGCTGCTCGCCGCCAACTCGCCGATCCTCCAGTTGTTGCTGGAGGTCCGTGAGAACACCCGTTTCC
CGGTCCTGGCGGAGAGCGCCGAGGCGCTGGCAGAGGCCAGCGACAAGGCCGCGGAAAAGGGCGGCAAGCT
GGGCAAGGCGGCCGCCGCGGCGGCCGGCAAGGCCAGGGACGCGTTGGCGAAGAACCTGCCGGATACCGCG
AAGAAGTCCCTGCAACGCCGCTTCGAGCCCCTGCATCGCCTGCTCGACGATAACAACGGCCCGGCGGCCG
ACCTCACCCCGCTGTTGCAGGCGCTCAACGAGTTGCAGTTGCAACTCGCCGGACTGGCGCGCGCCAGCCA
GCCGGAGCAGGCGGCTTTCGACATGGCGAAGAGCCGCATGGGCGGCCAGCGCGATGCCCTGAGCAACCTG
CGCAACGCCTCCGCGCGACTGCCGCGACCGCTCGGCGGATGGTTCAGCGTGCTGGCCGAAGACGCCTGGC
GGCTGGTCCTCGGCGATGCCTACCTGTACCTCAACCAGCGCTACCAGAGCGAGCTGTACGGTTTCTACAG
CAAGGCGATCAACAAGCGCTACCCGTTCAACGCGCACAGCGCCAGCGATGTCGCGGTCAGCGATTTCCGC
GAGTTCTTCAAGGCGCAGGGCGTCGCCGAACGCTTCTTCGAAACCTACATGCGGCCCTTCGTCAGCGGCG
ACCCGGGCAGCTACCGCCTGCGCAGCGTGGACGGCTACAGCCTGCCGATGTCCAAGGTCTATCTCGACCA
GATGGGCACGGCCCAGGTGATCCGCCAGAGCTTCTTCGCCGAGAACCCGGCCGAGCCACAGGTGCGCTTC
CGCCTGGAGCCCTATACCCTCGATCCTGGCGTCAGCCGCGCCGAGTTCCGTTTCGACGGTCAGTCCATGG
AGTACCGCCACGGCCCGATCGTGCCGATGTCGTTCAAGTGGCCCAGCGACGCCGACGGCGGCCGCACCAG
CCTGGTGCTGGAGAAGATGGCCGGACGACCGGTGGGAATCGAACGCAATACCGGGCCCTGGTCGCTGTTC
AGGCTGTTCGACCTGATGCAGACCGAGTACCTCAGCGGGCGTGACGTGATGGTGCTCAAGGCCGACCTGG
GCGGCCTGCGCGCCAACTACCTGCTGCTCGCCCAGCGCACGCCGAATCCGTTCGATCTCGCGGTCCTGCG
CAGCTTCCGCATGCCGGTGCAGCTCTGA
 Primer design