SecReT6
Protein ID: 478479559
SecReT6 ID748
T6SS typei1
Gene symbol-
Locus tagG655_16850
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]3714298..3715629 [-]
Producthypothetical protein
NoteTssK
UniProt IDM9S1P0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.20E-144, Aligned region: 18..442
Protein Sequence: 443 a.a.     [Download]
>gi|478479559|ref|YP_007710210.1| hypothetical protein G655_16850 [Pseudomonas aeruginosa B136-33]
MNVHKIVWQEGMLLRPQHLQHNDRYYDNQMKARTQLLGSYNWGFLALELDRQFLNMGKLVISQASGVLPD
GSLFELGGNTEPLALDVPPNTSNVPIYLALPLVTGNHIEARRPEQAEVLARYTAYDLEVADSNAGEDSMV
QVSCARPDFRLLLGEQQSDQAYVKLKVAVVLDTTPDGVISLDPDFVPSYLHAHASAYLLSCLKEVISMLG
HRGDTIAERIRSNGKVGGAEVGDFMMLQLINRTELLLRHYLGLEQVHPEQLYRVLLTMLGDLATFGSESK
RPRLDSRYQHSDQGASFRRLMEAIRQVLSMVLEQHAIELPLQARQYGILVSPLHDHKLLGSASFVLAASA
NCESEELRQRLPAHLKVGAVEHIRQLVNLHLPGIRVKPLPVAPRQIPFHSNKTYFILEPNAEDMTQLERS
GGFAFHVSGEFSELELKFWAIRN
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|478476202|ref|NC_020912.1|:c3715629-3714298 Pseudomonas aeruginosa B136-33, complete genome
ATGAACGTGCACAAGATCGTCTGGCAGGAAGGCATGCTGCTGCGCCCGCAGCACCTGCAACACAACGACC
GCTACTACGACAACCAGATGAAGGCCCGGACCCAGTTGCTGGGCAGCTACAACTGGGGCTTCCTCGCCCT
GGAGCTGGACCGCCAATTCCTCAACATGGGCAAGCTGGTGATCAGCCAGGCCTCCGGCGTATTGCCCGAC
GGCAGCCTGTTCGAACTCGGCGGCAACACCGAGCCGCTCGCCCTCGACGTGCCGCCCAATACCTCGAACG
TGCCGATCTACCTGGCCCTGCCGCTGGTCACCGGCAACCACATCGAGGCGCGCCGGCCGGAGCAGGCCGA
GGTCCTGGCGCGCTATACCGCCTACGACCTGGAGGTGGCGGACTCCAACGCCGGCGAGGATTCCATGGTG
CAGGTCAGCTGCGCGCGGCCGGATTTTCGCCTGCTGCTCGGCGAGCAGCAGAGCGATCAGGCCTACGTCA
AACTGAAGGTGGCGGTGGTGCTGGATACCACGCCGGACGGGGTGATCAGCCTCGACCCCGACTTCGTGCC
GAGCTACCTCCATGCCCACGCATCCGCCTACCTGCTGTCCTGCCTGAAGGAGGTGATTAGCATGCTCGGC
CATCGCGGCGACACCATCGCCGAGCGTATCCGGTCCAATGGCAAGGTCGGCGGCGCGGAGGTCGGCGATT
TCATGATGCTGCAACTGATCAATCGCACCGAGTTGCTGCTGCGCCACTACCTGGGATTGGAGCAGGTGCA
TCCGGAGCAGTTGTACCGGGTGCTGCTGACCATGCTCGGCGACCTCGCCACCTTCGGCAGCGAGAGCAAG
CGTCCGCGCCTGGACAGCCGTTACCAGCACAGCGACCAGGGCGCTAGCTTCCGCAGGCTGATGGAGGCGA
TTCGCCAGGTCCTGTCGATGGTGCTCGAGCAGCATGCCATCGAACTGCCTCTCCAGGCCCGCCAGTACGG
CATCCTGGTCTCGCCCCTGCACGACCACAAGCTGCTCGGCAGCGCCTCGTTCGTGCTCGCCGCCAGTGCC
AATTGCGAGTCGGAGGAACTGCGCCAGCGCCTGCCCGCGCATCTCAAGGTGGGTGCGGTCGAGCACATTC
GCCAGTTGGTCAACCTGCACCTGCCGGGGATCCGGGTCAAGCCGCTGCCGGTGGCGCCGCGGCAGATCCC
GTTCCACTCCAACAAGACCTATTTCATTCTCGAACCCAACGCCGAGGATATGACCCAGCTGGAGCGCTCC
GGCGGTTTCGCGTTCCACGTATCCGGCGAGTTCTCCGAGCTTGAACTGAAATTCTGGGCCATCAGGAACT
GA
 Primer design