SecReT6
Protein ID: 478479560
SecReT6 ID748
T6SS typei1
Gene symbol-
Locus tagG655_16855
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]3715626..3716132 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDM9S9Z2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-42, Aligned region: 19..154
Protein Sequence: 168 a.a.     [Download]
>gi|478479560|ref|YP_007710211.1| putative lipoprotein [Pseudomonas aeruginosa B136-33]
MSRRPIPPARALAMLAVLALLAGCSTLSPYSRLTKLDLALSAGERVNPDLNGRPSPVVVRLFELKHPVAF
ENADFFSLYERPKETLDPDLVTSEELELRPGERVELKLSVEEGSRYVGVLAAYRDLGEASWRYVVPVTAK
ELTRVELKLGRKGILNAGELLGKAGDAR
 
Nucleotide Sequence: 507 bp     [Download]
>gi|478476202|ref|NC_020912.1|:c3716132-3715626 Pseudomonas aeruginosa B136-33, complete genome
ATGTCTCGTCGCCCGATTCCGCCAGCCAGGGCGCTGGCCATGCTCGCCGTCCTGGCGCTGCTGGCCGGCT
GTTCCACGCTGTCGCCGTATTCCAGACTGACCAAGCTCGACCTCGCCCTGAGCGCCGGCGAGCGGGTCAA
TCCCGACCTCAATGGCCGGCCGTCGCCGGTGGTAGTGCGGCTGTTCGAGCTGAAGCACCCGGTGGCGTTC
GAGAACGCCGACTTCTTCAGCCTCTACGAACGTCCCAAGGAGACCCTGGACCCCGACCTGGTGACCAGTG
AGGAGCTGGAGCTGCGGCCCGGCGAGCGGGTCGAACTCAAACTCAGCGTGGAGGAGGGGAGCCGCTACGT
GGGCGTGCTCGCCGCCTACCGCGATCTCGGCGAGGCAAGCTGGCGCTACGTGGTGCCGGTCACGGCGAAA
GAGCTGACCCGGGTAGAGCTGAAGCTGGGCCGGAAGGGCATCCTGAATGCCGGCGAACTGCTCGGCAAGG
CGGGTGACGCGCGATGA
 Primer design