SecReT6
Protein ID: 478479561
SecReT6 ID748
T6SS typei1
Gene symbol-
Locus tagG655_16860
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]3716138..3717331 [-]
Producthypothetical protein
NoteFha
UniProt IDM9S858
KEGG IDpsg:G655_16860
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 6.60E-14, Aligned region: 30..96
Protein Sequence: 397 a.a.     [Download]
>gi|478479561|ref|YP_007710212.1| hypothetical protein G655_16860 [Pseudomonas aeruginosa B136-33]
MELVLEMLSAKQFVPTELCSKTFGRNGGLIGRGGECDWAIPDRKRHLSKQHARVSYRNGAFYLTDTSSNG
IRAGNGSRLPHGEPQRIEQDSVFLLGDFEIRARLLREPDEFAMDVGRPQPAGSIIPDDAFLALDPLQALD
QDGADAYELDDLSAIAQPSQEAGARADYARIDMESLVVPELVPAPAAPQEPVESPRPGHDEAFWQRFGQA
LGMDLEGLDGAAREALAINAAGLLRQCIGGLQQSLRTRSELKNELRLSLSTLRDTGKNPLRFSADAGEAL
GHLLRDGKPGQLSGEQAVARSFRDLQAHQVALLGASRAAVRATLEHFSPQQLTLRFERDGRRPLLATSGS
RWRAYGRYHQSLCQDDDWSERLLARDFAQAYEEQVRLISTLYTEHQG
 
Nucleotide Sequence: 1194 bp     [Download]
>gi|478476202|ref|NC_020912.1|:c3717331-3716138 Pseudomonas aeruginosa B136-33, complete genome
ATGGAACTGGTATTGGAAATGCTCAGCGCCAAGCAATTCGTACCGACGGAGCTGTGCAGCAAGACCTTCG
GCAGGAACGGCGGCCTCATCGGCCGCGGCGGTGAGTGCGACTGGGCGATTCCCGATCGCAAGCGGCACCT
GTCCAAGCAGCATGCGCGGGTCAGCTATCGCAACGGCGCGTTCTACCTGACCGACACCAGCAGCAACGGC
ATCCGCGCCGGCAACGGCAGCCGCCTGCCGCATGGCGAGCCGCAGCGCATCGAGCAGGACAGCGTCTTCC
TGCTCGGCGACTTCGAGATCCGCGCGCGGCTGCTGCGCGAGCCCGACGAGTTCGCCATGGACGTCGGGCG
GCCGCAGCCGGCGGGCAGCATCATTCCGGACGATGCCTTCCTGGCCCTCGATCCGTTGCAGGCGCTCGAC
CAGGACGGTGCAGATGCCTACGAGCTCGACGACCTGAGCGCGATCGCCCAGCCCAGCCAGGAGGCCGGGG
CGCGTGCGGACTACGCGCGGATCGACATGGAAAGCCTGGTCGTACCGGAGCTGGTGCCCGCCCCGGCGGC
TCCGCAGGAACCCGTGGAAAGTCCGCGTCCGGGTCACGACGAAGCCTTCTGGCAGCGTTTCGGCCAGGCT
CTGGGAATGGACCTCGAAGGCCTCGACGGCGCTGCGCGCGAAGCGCTGGCGATCAACGCCGCCGGTTTGC
TGCGGCAGTGCATCGGCGGCTTGCAGCAGAGCCTGCGGACCCGCAGCGAACTGAAGAACGAACTGCGCCT
GTCGCTGAGCACGTTGCGCGATACCGGCAAGAATCCCTTGCGCTTCAGCGCCGATGCCGGCGAGGCGCTG
GGGCATCTGCTACGGGATGGCAAGCCTGGCCAGTTGAGTGGCGAACAGGCCGTCGCACGCAGTTTCCGCG
ACCTCCAGGCGCACCAGGTGGCGCTGCTCGGCGCCAGCCGGGCGGCGGTGCGCGCGACCCTCGAGCATTT
CTCGCCGCAGCAGCTGACCCTGCGTTTCGAGCGCGACGGCCGCCGGCCGTTGCTGGCCACCTCGGGCAGC
CGCTGGCGTGCCTATGGTCGCTACCACCAGTCGCTATGCCAGGACGACGACTGGAGCGAGCGCCTGCTGG
CACGTGATTTCGCCCAGGCCTACGAAGAGCAGGTTCGCCTGATTTCCACCCTCTACACCGAGCACCAAGG
ATGA
 Primer design