SecReT6
Protein ID: 478479563
SecReT6 ID748
T6SS typei1
Gene symbol-
Locus tagG655_16870
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]3717578..3719089 [-]
Producttranscriptional regulator
NoteSfa2
UniProt IDM9S4B1
KEGG IDpsg:G655_16870
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 1.90E-70, Aligned region: 195..362
Sigma54_activ_2 [PF14532], Evalue: 5.30E-21, Aligned region: 196..366
HTH_8 [PF02954], Evalue: 4.20E-13, Aligned region: 352..359
HTH_8 [PF02954], Evalue: 4.20E-13, Aligned region: 454..493
AAA_5 [PF07728], Evalue: 1.80E-07, Aligned region: 219..337
GAF_3 [PF13492], Evalue: 9.60E-05, Aligned region: 27..149
GAF_3 [PF13492], Evalue: 9.60E-05, Aligned region: 202..261
HTH_30 [PF13556], Evalue: 0.00027, Aligned region: 463..495
GAF_2 [PF13185], Evalue: 0.00049, Aligned region: 29..174
GAF_2 [PF13185], Evalue: 0.00049, Aligned region: 286..290
Protein Sequence: 503 a.a.     [Download]
>gi|478479563|ref|YP_007710214.1| transcriptional regulator [Pseudomonas aeruginosa B136-33]
MFSRVPQPLAFAEALLAQFGALSRETDIAALLGGFARAVGELSGCELSQLYLLDQTHTALTLNAECRDGL
LQALEPSSLPADYTGEQLLQFALCQNRVVSLVDLPSRLHETGFLPAGEQPWLSLLCVPLVSPEKTVEGMV
VCATRRPLDLQGFAHPLGQLGSFVLAQLHLLQRLSQPSGEPQGPSSAPVVSGYGLIGRSAAMRETCRLIS
KVLHNPYTVLLQGETGTGKEVVARAIHEYGPRRAQAFVVQNCAAFPENLLESELFGYRKGAFTGAERDRP
GLFDAADGGTLLLDEIGDMPLSLQAKLLRVLQEGEIRPLGGNDTHKVDVRIIAATHRDLALLVRDGKFRE
DLYYRLAQFPIELSPLRQREGDALELARHFAERACVFLRRAPLGWSAEALELLDGYGFPGNVRELKGLVE
CAVLLCEGDVLLAEHFSLRAPPEAEAPLKLREHLEQIERDLLLACLRRNAGNQTLAARELGLPRRTLIYR
MGRLNIHFGDPRT
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|478476202|ref|NC_020912.1|:c3719089-3717578 Pseudomonas aeruginosa B136-33, complete genome
ATGTTCAGCCGCGTACCGCAACCCCTGGCCTTCGCCGAAGCCCTGCTCGCTCAGTTCGGCGCGCTGTCGC
GGGAAACAGACATCGCGGCCCTGCTGGGCGGTTTCGCACGCGCAGTCGGCGAACTCAGCGGCTGCGAGCT
GAGCCAGCTGTATCTGCTCGACCAGACCCATACCGCGCTCACCCTCAACGCCGAATGCCGGGACGGCCTG
TTGCAGGCGCTGGAGCCGTCGAGCCTGCCGGCGGACTACACCGGCGAGCAGTTGCTGCAGTTCGCCCTGT
GCCAGAACCGCGTGGTCAGTCTCGTCGACCTGCCGTCGCGGCTGCACGAGACCGGCTTCCTGCCGGCAGG
GGAGCAGCCCTGGCTGTCCCTGCTCTGCGTTCCGCTGGTGAGCCCGGAGAAAACGGTCGAGGGCATGGTG
GTCTGCGCCACCCGGCGCCCACTGGACCTGCAGGGATTCGCCCATCCACTGGGCCAGTTGGGCTCGTTCG
TGCTGGCCCAGCTGCATCTGCTGCAACGCCTCTCGCAACCCTCCGGCGAGCCGCAGGGACCGTCCAGCGC
GCCGGTGGTCAGCGGCTACGGGCTGATCGGCAGGAGCGCGGCGATGCGTGAGACCTGCCGCCTGATCAGC
AAGGTCCTGCACAACCCCTATACCGTGTTGCTGCAGGGCGAGACCGGCACCGGCAAGGAGGTGGTCGCAC
GGGCGATCCACGAGTACGGCCCGCGGCGAGCACAGGCGTTCGTGGTGCAGAACTGCGCGGCGTTTCCGGA
AAACCTGCTGGAAAGCGAGCTGTTCGGCTACCGCAAGGGCGCCTTTACCGGTGCCGAGCGCGATCGTCCC
GGGTTGTTCGATGCCGCGGATGGCGGAACCCTGCTGCTCGACGAAATCGGCGACATGCCCCTGTCGCTCC
AGGCCAAGCTGTTGCGCGTGTTGCAGGAAGGCGAGATTCGCCCGCTCGGCGGCAACGACACGCACAAGGT
CGATGTACGCATCATCGCCGCTACCCACCGTGACCTCGCCCTGCTGGTCCGCGATGGCAAGTTCCGCGAA
GACCTCTACTACCGGCTGGCGCAGTTTCCCATCGAGTTGTCGCCGTTGCGCCAGCGCGAGGGCGACGCCC
TCGAACTGGCCCGGCATTTCGCCGAACGCGCCTGCGTGTTCCTGCGCCGCGCGCCGCTGGGCTGGTCCGC
GGAAGCGCTGGAACTGCTCGACGGCTATGGCTTTCCCGGCAACGTTCGGGAGCTGAAGGGACTGGTGGAA
TGCGCGGTACTGCTCTGCGAAGGCGATGTGCTGCTGGCCGAACACTTTTCCCTGCGCGCGCCCCCGGAAG
CGGAGGCGCCGCTCAAGCTGCGCGAGCACCTGGAGCAGATCGAGCGCGACCTGCTGCTCGCCTGCCTGCG
CAGGAACGCTGGCAACCAGACCCTCGCTGCGCGCGAACTGGGTCTGCCGCGCCGAACCCTGATCTATCGC
ATGGGACGCCTGAACATTCATTTCGGCGATCCCCGGACCTGA
 Primer design