SecReT6
Protein ID: 478479565
SecReT6 ID748
T6SS typei1
Gene symbol-
Locus tagG655_16880
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]3721740..3722747 [-]
Producthypothetical protein
NoteTssG
UniProt IDM9S9Z7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.70E-88, Aligned region: 19..321
Protein Sequence: 335 a.a.     [Download]
>gi|478479565|ref|YP_007710216.1| hypothetical protein G655_16880 [Pseudomonas aeruginosa B136-33]
METAHGFAAPAVSALARGIREYSLFQAVLLVMDRLREEYPGLGDEALYDQLEFQANPSLGFPGSDVDRVE
FFEERGMLRARLRFNLIGLFGANSPLPAFYSEQALGDSEEGNPTRNFLDLFHHRLHRLLLPIWRKYRYRV
SFQSGASDAFSAQLFALVGLGGEEIRKARELNWKRLLPYLGLLSLRAHSAALIESVLRYYFKHAELLAEQ
CIERRVAILEEQRNRLGLFNSQLGEDAVLGERVRDRSGKFRIHIRQLDWQRFHEFLPIGPGYQPLCALVR
FTLRDPLDYDIRLVLRHEEIREFRIGAQNACRLGWTSWLGRERADGVVTLGSKIH
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|478476202|ref|NC_020912.1|:c3722747-3721740 Pseudomonas aeruginosa B136-33, complete genome
ATGGAAACCGCGCATGGGTTTGCAGCCCCTGCTGTAAGCGCGCTGGCCCGGGGCATTCGCGAGTACTCGC
TGTTCCAGGCGGTCCTGCTGGTCATGGATCGCCTGCGCGAGGAATATCCCGGCCTGGGAGACGAGGCGCT
CTACGATCAGTTGGAATTCCAGGCCAATCCTAGCCTCGGCTTCCCGGGCAGCGATGTCGATCGGGTGGAG
TTCTTCGAAGAGCGTGGCATGCTGCGGGCGCGGCTGCGTTTCAACCTGATCGGCTTGTTCGGTGCCAATT
CGCCGTTGCCGGCGTTCTACAGCGAGCAGGCCCTGGGCGACAGCGAGGAGGGCAATCCTACGCGGAACTT
CCTCGATCTCTTCCATCACCGCCTGCATCGGCTGCTGTTGCCGATCTGGCGCAAGTACCGTTACCGGGTG
AGCTTCCAGAGCGGTGCGAGCGATGCGTTCTCCGCTCAGTTGTTCGCCCTCGTCGGATTGGGCGGGGAAG
AGATCCGCAAGGCCAGGGAACTGAACTGGAAACGCCTGCTGCCCTACCTGGGCCTGCTCAGCCTGCGGGC
GCACTCGGCGGCCTTGATCGAGTCGGTGCTGCGCTACTACTTCAAGCATGCCGAACTGCTCGCCGAGCAG
TGTATCGAACGGCGCGTCGCGATCCTCGAAGAGCAGCGCAACCGACTCGGCCTGTTCAACAGCCAGCTTG
GCGAAGACGCGGTGCTGGGCGAACGGGTCCGCGACCGCAGCGGCAAGTTCCGCATTCATATCCGCCAGCT
CGACTGGCAGCGCTTCCACGAGTTCCTGCCGATCGGTCCCGGCTACCAGCCGCTTTGCGCGCTGGTCCGC
TTCACCCTGCGCGACCCGCTCGACTACGACATCCGGCTGGTCTTGCGCCACGAGGAAATCCGCGAGTTCC
GCATCGGCGCGCAGAACGCCTGCCGCCTTGGCTGGACCAGTTGGCTGGGCCGAGAGCGCGCCGATGGCGT
GGTGACGCTGGGCAGCAAGATTCATTAA
 Primer design