SecReT6
Protein ID: 478479566
SecReT6 ID748
T6SS typei1
Gene symbol-
Locus tagG655_16885
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]3722711..3724498 [-]
Producthypothetical protein
NoteTssF
UniProt IDM9S866
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-184, Aligned region: 3..595
Protein Sequence: 595 a.a.     [Download]
>gi|478479566|ref|YP_007710217.1| hypothetical protein G655_16885 [Pseudomonas aeruginosa B136-33]
MSFNHYYQSELTALRQLGRRFAERSPALAPFLGQVGRDPDVERLLEGFAFLTGRLRQKLDDELPELSHSM
MHLLWPNYMRPLPAFSILQFDPLTRPGGALRVERDTPVESRPVGEVACRFRTCYATEVLPLVLEALNYSV
TGEGALLGLRLAMNCDGHLGELGLSRLRLHLAGERYISQMLYLCLLRNLESIQLIPLDAHGRPLDGVAGK
PMSFRLTGERVQPVGFAEDEALIPYPLNTFRGYRYLQEYFAFQDKFLFVDVDGLDLLGALPEETLKQVRG
LELRFDIRKSGIQRLHPTLENVKLYCTPVANLFRHDALPIRLDGKQDEYLLMPAEYSLEDCGVFSVEGVT
GWRPGGLGYQAYVPFESFEHDPSFDVPEARPHYSVRQRTSLLHDGLDTYLSFGIRHPEQIETLSVELTCT
NQNLPQRLRLGDICVACEGTPEFLGFRNITPATPSYAPPLNRDFLWKLISNMSLNYLSLANVDALKVILE
TYDLPRYYDQHAAKVSKRLLGGLKAVRHEHVDRLHRGLPLRGLRTELTIDPEGYIGEGDLFVFASVLNEF
FALYASINSYHELRVRSTQGDVYQWKPRMGLQPLL
 
Nucleotide Sequence: 1788 bp     [Download]
>gi|478476202|ref|NC_020912.1|:c3724498-3722711 Pseudomonas aeruginosa B136-33, complete genome
GTGTCCTTCAATCATTACTACCAGAGCGAACTCACCGCACTGCGCCAGCTGGGGCGCCGTTTCGCCGAGC
GTAGCCCGGCCCTGGCCCCGTTTCTCGGGCAGGTCGGACGCGATCCGGATGTCGAGCGCCTGCTCGAGGG
CTTTGCCTTCCTGACCGGGCGGTTGCGGCAGAAGCTGGACGACGAGTTGCCGGAACTCAGCCACTCGATG
ATGCACCTGCTGTGGCCGAACTATATGCGCCCGCTGCCGGCTTTCAGCATTCTCCAGTTCGACCCCCTGA
CCCGCCCGGGCGGGGCGCTGCGCGTGGAGCGCGATACGCCGGTCGAGAGCCGGCCGGTGGGCGAGGTCGC
CTGTCGCTTCCGTACCTGCTACGCCACCGAGGTCCTGCCGCTGGTGCTGGAGGCGCTCAACTATTCGGTG
ACCGGCGAGGGAGCGCTGCTCGGACTGCGCCTGGCGATGAACTGCGACGGGCACCTCGGCGAGCTGGGCC
TGAGTCGGCTGCGCCTGCACCTGGCCGGCGAGCGCTACATCAGCCAGATGCTCTACCTGTGCCTGCTGCG
CAACCTGGAGAGCATCCAGCTGATTCCGCTGGACGCCCATGGGCGGCCGCTGGATGGCGTGGCCGGCAAG
CCGATGTCGTTCCGCCTGACGGGCGAGCGGGTGCAGCCGGTGGGTTTCGCCGAAGACGAGGCGTTGATTC
CCTATCCGCTGAATACCTTCCGTGGCTATCGCTACCTGCAGGAGTACTTCGCGTTCCAGGACAAGTTCCT
GTTCGTCGACGTGGATGGCCTGGACCTGCTCGGCGCGCTGCCCGAGGAAACCCTCAAGCAGGTCCGCGGC
CTCGAGTTGCGCTTCGATATCCGCAAGAGCGGCATCCAGCGCCTGCACCCGACGCTGGAGAACGTCAAGC
TGTACTGTACGCCGGTGGCCAACCTGTTCCGCCACGATGCGCTGCCGATCCGCCTCGACGGCAAGCAGGA
CGAGTACCTGCTGATGCCGGCCGAATACAGCCTGGAGGACTGCGGGGTGTTCTCGGTAGAAGGCGTCACT
GGCTGGCGGCCGGGCGGGCTCGGCTACCAGGCTTACGTACCGTTCGAGTCCTTCGAGCACGATCCCAGCT
TCGACGTTCCCGAAGCACGGCCCCACTACAGCGTCCGGCAACGGACCTCGTTGCTGCACGATGGCCTGGA
CACCTACCTGAGCTTCGGCATCCGCCATCCCGAGCAGATCGAGACGCTGTCGGTGGAACTGACCTGCACC
AACCAGAACCTGCCCCAACGGCTGCGCCTGGGCGATATCTGCGTCGCCTGCGAAGGCACGCCGGAATTCC
TCGGTTTCCGCAATATCACTCCGGCGACGCCGAGCTACGCGCCGCCGCTGAACCGCGATTTCCTCTGGAA
GCTGATCAGCAACATGTCGCTCAACTACCTGTCGCTGGCCAACGTCGACGCGCTCAAGGTGATCCTCGAA
ACCTACGACCTGCCGCGCTACTACGACCAGCATGCGGCGAAGGTCAGCAAGCGCCTGCTGGGCGGGCTCA
AGGCGGTCCGCCACGAGCATGTCGACCGCCTGCATCGGGGCCTGCCGCTGCGCGGCTTGCGTACCGAGCT
GACGATCGATCCGGAAGGCTACATCGGCGAGGGCGACCTGTTCGTGTTCGCTTCGGTTCTGAACGAATTT
TTCGCGCTTTACGCCAGCATCAACTCCTACCACGAGTTGCGGGTGAGGAGCACACAGGGAGACGTGTACC
AATGGAAACCGCGCATGGGTTTGCAGCCCCTGCTGTAA
 Primer design