SecReT6
Protein ID: 478479567
SecReT6 ID748
T6SS typei1
Gene symbol-
Locus tagG655_16890
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]3724830..3725237 [-]
Producthypothetical protein
NoteTssE
UniProt IDM9S3A7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.20E-18, Aligned region: 24..114
Protein Sequence: 135 a.a.     [Download]
>gi|478479567|ref|YP_007710218.1| hypothetical protein G655_16890 [Pseudomonas aeruginosa B136-33]
MTGYGSLFERLNGDADKRVGWSREVSAMASVAAHLGKMLSTRAGSVQTLSDYGLPDLNDMRLSLHDSLSQ
ARSAIEGFIEAYEPRLSNVRVVSLPRDNDQLRLAFSIEGLLEVEGFKRQVSFSACLDGSGQVKVS
 
Nucleotide Sequence: 408 bp     [Download]
>gi|478476202|ref|NC_020912.1|:c3725237-3724830 Pseudomonas aeruginosa B136-33, complete genome
ATGACCGGATACGGCAGCCTGTTCGAGCGCCTGAACGGCGACGCGGATAAGCGCGTCGGCTGGAGCCGCG
AGGTTTCCGCCATGGCGTCGGTGGCTGCCCATCTGGGCAAGATGCTCAGCACCCGGGCGGGCAGCGTGCA
GACGCTGTCCGACTACGGGTTGCCCGATCTCAACGACATGCGCCTGAGCCTGCACGACTCCCTGAGCCAG
GCCCGCTCGGCCATCGAAGGTTTCATCGAGGCTTACGAACCGCGCTTGAGCAACGTGCGTGTCGTTTCCC
TGCCGCGCGACAACGACCAGCTCCGCCTGGCCTTCAGCATCGAAGGGTTGCTGGAGGTGGAAGGTTTCAA
GCGCCAGGTGAGTTTTTCCGCATGCCTGGATGGCAGCGGCCAGGTGAAGGTCAGCTAA
 Primer design