SecReT6
Protein ID: 478479570
SecReT6 ID748
T6SS typei1
Gene symbol-
Locus tagG655_16905
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]3727296..3728852 [-]
Producthypothetical protein
NoteTssA
UniProt IDM9SA01
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.20E-22, Aligned region: 55..115
Protein Sequence: 518 a.a.     [Download]
>gi|478479570|ref|YP_007710221.1| hypothetical protein G655_16905 [Pseudomonas aeruginosa B136-33]
MTYSSKLSSHYLELAEQPISKDVFAGEDVRFSSEYEALENELGKALSLHENGQTDWLKILENSEALLRAQ
SKDLRVAAWLTWALYQRESFPGLLAGLGLLERLCSRHWVEIHPLKARTRAAAIAWLVPRLEQALNENVPI
KEQLPLFRRLAEHLEKLDTALTAQLGDDAPLLLPISRRLSGMLQRAADNQPEPGVVGAVVAQVKQAASQL
LAPGAPIDNERDAHKAMRAQQEAARPLCAWWLKQKATDLRALRLNRTMLWLPIESMPERNAEQVTALRGV
PADKLKSYQERFAQGLYADLLVELEASLARAPFWFDGQRLVWECLQGLNAEQAMREVEMHFALLLQRLPG
LVELRFHDGSAFADAATRGWISAHVMPHLQNDSAPRKVETVALQAEWDVALDEVQPVLRKDGLKAAVQVL
KQGMKRAHGGRARFFWQLSLARLCFLAKKYELAKTQLESLDHQLHESGLHAWEPDLALDVLHLLHSCCEL
LPQNHAVRERKEDIYRRLCHLDLEVVLE
 
Nucleotide Sequence: 1557 bp     [Download]
>gi|478476202|ref|NC_020912.1|:c3728852-3727296 Pseudomonas aeruginosa B136-33, complete genome
ATGACCTATTCGAGCAAGCTCTCCTCGCATTATCTGGAACTCGCGGAACAGCCGATTTCAAAGGATGTCT
TTGCGGGTGAGGATGTGCGTTTTTCCAGCGAATACGAGGCGCTGGAAAATGAGCTGGGCAAGGCGCTCTC
GCTCCATGAGAACGGCCAGACCGACTGGTTGAAAATCCTGGAAAACAGCGAAGCGCTGCTTCGTGCCCAA
TCCAAGGACCTGCGTGTTGCAGCCTGGTTGACCTGGGCCCTCTACCAACGGGAATCCTTTCCCGGTTTGC
TGGCCGGACTGGGATTGCTGGAACGTCTGTGCAGCCGGCATTGGGTCGAGATCCATCCGCTCAAGGCGCG
CACTCGCGCCGCGGCCATTGCCTGGCTGGTGCCCCGGCTGGAGCAGGCGCTGAACGAGAACGTACCGATC
AAGGAGCAACTCCCCCTGTTCCGGCGTCTCGCCGAGCACCTGGAAAAACTCGATACCGCGCTGACCGCGC
AACTGGGCGACGACGCGCCCTTGTTGCTGCCGATCAGCCGACGCCTTTCGGGCATGCTCCAGCGCGCCGC
CGACAACCAGCCCGAACCTGGCGTGGTCGGCGCCGTGGTGGCCCAGGTCAAGCAGGCGGCCAGCCAGTTG
CTGGCGCCGGGTGCGCCCATCGACAACGAGCGCGACGCCCACAAGGCCATGCGCGCCCAGCAGGAGGCCG
CACGCCCCCTGTGCGCCTGGTGGCTGAAGCAGAAAGCCACCGATCTGCGCGCGCTGCGCCTCAACCGGAC
GATGCTCTGGCTGCCCATCGAGTCCATGCCCGAGCGCAATGCCGAACAGGTCACCGCGCTAAGGGGAGTG
CCGGCGGACAAGCTGAAAAGCTACCAGGAGCGTTTCGCCCAGGGCCTGTACGCCGATCTCCTGGTGGAGC
TGGAGGCGAGCCTGGCACGGGCGCCGTTCTGGTTCGACGGCCAGCGCCTGGTCTGGGAGTGCCTGCAAGG
GCTCAACGCCGAGCAGGCGATGCGGGAAGTCGAAATGCATTTCGCCTTGCTCCTGCAGCGTCTGCCGGGG
CTGGTGGAGCTGCGTTTCCACGACGGCAGCGCATTCGCCGATGCGGCCACCCGCGGCTGGATCAGCGCCC
ATGTCATGCCCCATCTCCAGAACGACAGTGCGCCGCGCAAGGTCGAGACCGTGGCCCTGCAGGCCGAATG
GGACGTCGCCCTGGACGAGGTCCAGCCGGTGTTGCGCAAGGACGGCTTGAAGGCGGCGGTACAGGTGTTG
AAGCAGGGCATGAAGCGCGCCCACGGCGGGCGCGCCCGGTTCTTCTGGCAACTGAGCCTCGCGCGACTGT
GCTTCCTGGCGAAGAAGTACGAGCTGGCCAAGACCCAGCTGGAGAGCCTCGACCATCAGTTGCACGAATC
GGGATTGCACGCCTGGGAGCCCGATCTGGCGCTGGATGTACTGCACCTGCTGCATAGCTGCTGCGAGCTG
TTGCCGCAGAACCACGCCGTGCGAGAACGCAAGGAAGACATTTATCGCAGGCTGTGCCACCTCGATCTCG
AGGTGGTGCTCGAATAG
 Primer design