SecReT6
Protein ID: 478479572
SecReT6 ID748
T6SS typei1
Gene symbol-
Locus tagG655_16915
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]3730268..3732310 [+]
Producthypothetical protein
NoteTssI
UniProt IDM9S3B5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-69, Aligned region: 29..322
Phage_GPD [PF05954], Evalue: 1.50E-69, Aligned region: 387..407
Phage_GPD [PF05954], Evalue: 1.50E-69, Aligned region: 528..543
Phage_base_V [PF04717], Evalue: 1.60E-26, Aligned region: 371..464
DUF2345 [PF10106], Evalue: 5.90E-05, Aligned region: 539..571
DUF2345 [PF10106], Evalue: 5.90E-05, Aligned region: 573..616
Protein Sequence: 680 a.a.     [Download]
>gi|478479572|ref|YP_007710223.1| hypothetical protein G655_16915 [Pseudomonas aeruginosa B136-33]
MFAAANQTHFSLAIDGLALDLQVLSFSGREAISQPFAFDLELVGERPVPDLESLLHKPAFLTLGPAGNGI
HGLVRSAGQGDSGKRLTRYRITLVPQLAYLAQRTNQRIFQHLTVPQIVGLILEEHGILADAYRFQLGTRY
PEREYCVQYDESDLQFVQRLCCEEGIHFHFQHSATAHLLVFGDDQTVFPRLAPVAYQQDSGLVADRPAVK
RFGVRLETRTSRVTRRDYDFEKPRLTLESAARGEARPDLEDYDYPGRFVDRERGKHLARRALERQRSDYR
LAEGRSDQPLLLSGHFLPLAAHPQAGWNDLWLLTEVIHEGRQPQVLEESIVSDTSASPDDFRQGYRNRFQ
ATPWEAFFRPPPTPPKPRILGTQSAVVTGPKGEEIHCDRYGRVKVQFHWDREGQADDSSSCWLRVASGWA
GRNYGAIAIPRVGMEVLVTFLEGDPDQPLVTGCLFHREHPVPYELPAHKTRSVFKSLSSPGGGGYNELRI
EDRKGQEQIFVHAQRDWDENIEHDQKIRVGHQRHDTVEANSYSEFKAEEHRTTHAERKVEVRASDHLTVA
NDQHLKIASGQFVEAGQEIHLSSGLKVVLEAGAELTLKGGGSFLKLDASGVTLSGANVRVNSGGSPGSGS
GAAPLLPGPLRQADSDKAGALLTPAQINTLKRNAPFCEECEKCKDGACDL
 
Nucleotide Sequence: 2043 bp     [Download]
>gi|478476202|ref|NC_020912.1|:3730268-3732310 Pseudomonas aeruginosa B136-33, complete genome
ATGTTCGCAGCAGCCAACCAGACCCATTTCAGCCTCGCCATCGACGGCCTCGCCCTCGACCTGCAGGTGC
TCTCCTTCAGCGGCCGCGAAGCCATCAGCCAGCCGTTCGCCTTCGACCTGGAGCTGGTCGGCGAACGCCC
CGTGCCGGACCTCGAAAGCCTGCTGCACAAACCCGCCTTCCTTACCCTCGGGCCCGCCGGCAACGGTATC
CACGGCCTGGTGCGCAGCGCCGGACAGGGCGACTCGGGCAAGCGCCTGACCCGCTACCGCATCACCCTCG
TCCCGCAACTGGCCTACCTCGCCCAACGCACCAACCAGCGCATCTTCCAGCACCTCACGGTGCCGCAGAT
CGTCGGCCTGATCCTGGAGGAACACGGCATCCTCGCCGACGCCTACCGCTTCCAGCTCGGCACCCGCTAC
CCCGAGCGCGAATACTGCGTGCAGTACGACGAGAGCGACCTGCAGTTCGTCCAGCGCCTGTGCTGCGAGG
AGGGCATCCACTTTCATTTCCAGCACAGCGCCACGGCGCACCTGCTGGTGTTCGGCGACGACCAGACGGT
GTTCCCGCGGCTCGCGCCGGTGGCCTACCAGCAGGACTCCGGCCTGGTCGCCGACCGGCCGGCGGTCAAG
CGCTTCGGCGTACGCCTGGAAACCCGCACCAGCCGCGTCACCCGCCGCGACTACGACTTCGAGAAACCGC
GCCTGACGCTGGAAAGCGCCGCCCGCGGCGAAGCCCGGCCGGACCTCGAGGACTACGACTATCCCGGTCG
CTTCGTCGACCGCGAGCGCGGCAAGCACCTGGCCAGGCGTGCCCTCGAACGGCAGCGCAGCGACTACCGC
CTGGCCGAGGGCCGCAGCGACCAACCGTTGCTGCTCAGCGGCCACTTCCTGCCGCTGGCCGCCCATCCCC
AGGCGGGCTGGAACGACCTCTGGCTGCTCACCGAGGTGATTCACGAGGGGCGGCAGCCGCAGGTGCTGGA
AGAAAGCATCGTCTCCGACACCTCGGCGAGCCCGGACGACTTCCGGCAGGGTTACCGCAACCGCTTCCAG
GCCACGCCCTGGGAGGCGTTCTTCCGTCCCCCGCCGACGCCGCCGAAGCCGCGCATCCTCGGCACGCAGA
GCGCGGTGGTGACCGGCCCGAAGGGCGAGGAAATCCACTGCGACCGCTACGGTCGGGTGAAGGTGCAATT
CCACTGGGATCGCGAGGGCCAGGCCGACGACAGCAGCAGTTGCTGGTTACGCGTTGCCTCCGGCTGGGCG
GGAAGGAACTACGGCGCCATCGCCATCCCGCGGGTCGGCATGGAGGTGCTGGTGACCTTCCTCGAAGGCG
ACCCCGACCAGCCGCTGGTCACCGGCTGCCTGTTCCACAGGGAACATCCGGTGCCCTACGAACTGCCGGC
GCACAAGACCCGCAGCGTCTTCAAGAGCCTCAGCAGTCCTGGCGGCGGTGGCTACAACGAGCTGCGCATC
GAGGACCGCAAGGGCCAGGAGCAGATCTTCGTCCATGCCCAGCGCGACTGGGACGAAAACATCGAGCACG
ACCAGAAGATCCGCGTCGGTCACCAACGCCACGACACCGTGGAGGCGAACAGCTACAGCGAGTTCAAGGC
CGAGGAACACCGCACCACCCACGCCGAGCGCAAGGTGGAGGTCCGCGCCAGCGACCACCTCACCGTAGCC
AACGACCAGCACCTGAAGATCGCCAGCGGCCAGTTCGTCGAGGCCGGCCAGGAGATCCACCTGAGCAGCG
GCCTGAAGGTGGTGCTGGAGGCCGGCGCCGAACTGACCCTGAAGGGCGGTGGCAGCTTCCTCAAGCTCGA
CGCCAGCGGCGTGACCCTCTCCGGGGCCAACGTCCGGGTCAACTCCGGCGGCAGCCCGGGCAGCGGCAGC
GGCGCGGCGCCGCTGTTGCCGGGGCCGCTGCGGCAGGCCGACAGCGACAAGGCCGGCGCCCTCCTCACCC
CGGCCCAGATCAATACCCTGAAGCGCAACGCGCCCTTCTGCGAAGAGTGCGAGAAGTGCAAGGACGGTGC
CTGTGACCTCTGA
 Primer design