SecReT6
Protein ID: 479192304
SecReT6 ID749
T6SS typei3
Gene symbol-
Locus tagKUM_1253
StrainTaylorella asinigenitalis 14/45
Repliconchromosome [GenBank: NC_021033] [Browse all T6SS(s) in this replicon]
Location [Strand]1299724..1303350 [-]
Producthypothetical protein
NoteTssM
UniProt IDI7ILF3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.90E-90, Aligned region: 99..123
ImcF-related_N [PF14331], Evalue: 2.90E-90, Aligned region: 212..478
ImcF-related_N [PF14331], Evalue: 2.90E-90, Aligned region: 1062..1078
IcmF-related [PF06761], Evalue: 3.00E-80, Aligned region: 232..268
IcmF-related [PF06761], Evalue: 3.00E-80, Aligned region: 529..837
DUF1215 [PF06744], Evalue: 3.30E-33, Aligned region: 948..1070
Protein Sequence: 1208 a.a.     [Download]
>gi|479192304|ref|YP_007822200.1| conserved hypothetical protein [Taylorella asinigenitalis 14/45]
MFSLINLFITRVFSFLFSRALWSFLGLVILSALIWFLGPALRVGEFAPLESRDVRMYLIIAIFAFYFLRL
FWRKYREGRLNAKLLGQLKSNKPKDTEKLTEKEREEVRVLSERFNEAIALLKQSRFEKGKDKSLSARFSK
QYLYQLPWYVFIGAPGSGKTTALVNSGLNFPLAEKFGRMALKGVGGTRNCDWWFTDEAVLLDTAGRYTTQ
DSNAATDEDEWKGFLKLLTKYRARQPINGVMLTVSVYDLLASTQEERAKHAVALKKRLQELRDELGTEFP
VYILVTKMDQLHGFEDYFDNLSVEEHQQVWGFTFPYEESQKDGFDFYEEYEKEFQVLQERLFDGLPDLLM
KNRNLESSSLAYLLPQQFANLRIVLGTFLTDVFSFSRLESKIVPRGVYFTSGTQGGVSFDKVSEELKDYL
QIDGISQHNKAPMLEGGKSYFLTDLLQNLIFKESGLAGVNLKWEKRYRQMQWIGYGLVGLLLLGALTLWF
NSYRNNSRYLDFVEEKLPVVQNHSNNIKISESGDVFSILPYLSLVKKLPNGENFLVDDAPFSYGFGLYQG
GKVKSASRSIYDDAIHQVFAPQIAKRIEKRLATMSDANIVIYYEALRAYLMMYEPEHYDKDYFTQWVLHD
VVADKSAQFNNEQFQLLREHMDYLFGQGAFVSPFPLNEELVQEARNRIDSHDLAQRAYLRAREILKQDPK
NDVTLMTLAGNQASTVFRRKSGDALNRGVNRIFSYEGYWNIFNKNIEKISIQLREDDEWVLGIDNTTFAD
GSANKLLNEVKKLYFVDYIREWDAFLADIEVIPPKNLSHAIELSRSMSSTNSPLTKFVKGVAGDTTLLRE
DVNFQRTLVDRATESASSMASSLTSLMGPLDTGDLIKGKEEPTKLESMVDNHFIGYHELAVSAGNNTPAP
IEGTIDLIEELYNFLTASETALRTKVSLPSQEVISKLQAESGRLPPVVGSMLTSITTEASKAINSGAQAN
IGADINAQIGMSCRNSITNRYPFRSTTRDVAPNDFARFFAPNGLMDQFFNKNLINMVDMSKRPWRFKPGV
DGSKGNIAKYLSSFEKAAVIRDVYFAGGKPEPSFKVSIRPVEMDASITQMVLNIDGQTLTYEHGPQVGKS
FDWPGQGSNQVSITLSPHDGTSSLTTNGPWALNRLIDNAKISRGRSPEVIFATFNIGGRSVKLEITANSA
KSPFRLGEMRSFVCPGVN
 
Nucleotide Sequence: 3627 bp     [Download]
>gi|479191087|ref|NC_021033.1|:c1303350-1299724 Taylorella asinigenitalis 14/45 draft genome
ATGTTCAGCCTTATTAATTTATTTATAACTAGAGTTTTCAGCTTTCTATTCAGTAGAGCATTATGGTCAT
TCCTAGGGCTGGTTATTCTTTCTGCGTTAATCTGGTTTTTGGGACCAGCTTTACGCGTAGGAGAGTTTGC
ACCGTTAGAGTCCCGAGATGTGAGGATGTACTTAATCATTGCCATCTTTGCGTTTTATTTTCTTAGATTA
TTCTGGAGAAAATATCGTGAGGGACGTTTAAATGCAAAACTTTTGGGTCAGCTCAAAAGCAATAAGCCTA
AAGATACCGAAAAACTTACCGAAAAAGAACGCGAAGAAGTACGTGTTTTATCTGAACGGTTTAACGAAGC
AATTGCATTACTAAAACAATCACGATTTGAAAAAGGGAAGGACAAATCGCTTTCAGCTAGATTTTCTAAG
CAATATTTATATCAATTGCCTTGGTATGTTTTTATTGGAGCGCCAGGTTCAGGAAAAACTACAGCATTAG
TAAATTCAGGTTTAAATTTCCCATTGGCTGAAAAATTCGGTCGTATGGCACTCAAAGGTGTGGGTGGTAC
GAGAAACTGTGATTGGTGGTTTACTGATGAAGCGGTTTTACTTGATACTGCTGGAAGATACACAACTCAG
GATAGTAATGCTGCTACTGATGAAGACGAGTGGAAGGGTTTCTTAAAACTTCTTACTAAATATAGAGCAA
GGCAGCCTATCAATGGCGTTATGCTTACTGTCAGTGTGTATGATTTGCTTGCATCAACTCAAGAAGAGCG
TGCAAAACATGCTGTAGCCCTTAAAAAACGTTTGCAGGAACTAAGAGATGAATTGGGGACAGAGTTCCCA
GTTTATATTTTGGTTACTAAGATGGACCAATTACACGGGTTTGAAGATTATTTCGATAATTTAAGTGTTG
AAGAACATCAACAAGTTTGGGGTTTTACATTTCCATACGAAGAGTCTCAAAAGGATGGTTTCGATTTTTA
TGAAGAATACGAGAAAGAATTCCAGGTTCTTCAAGAGCGTTTATTTGATGGGCTTCCAGACCTATTAATG
AAAAATCGAAATCTTGAAAGTAGTTCCTTGGCGTATTTATTGCCACAGCAATTTGCAAACTTAAGAATTG
TTTTAGGTACTTTCTTAACAGATGTATTTTCTTTTAGTCGCCTTGAATCAAAAATTGTCCCACGCGGTGT
TTATTTCACAAGCGGAACGCAAGGTGGCGTAAGTTTCGATAAGGTTAGTGAAGAACTTAAAGACTACCTT
CAAATCGATGGTATTTCTCAACATAATAAAGCACCGATGTTAGAAGGCGGAAAGAGTTACTTCTTAACTG
ATCTACTCCAAAATTTGATTTTCAAGGAATCTGGTCTTGCGGGCGTAAACCTTAAATGGGAAAAACGCTA
TCGCCAGATGCAGTGGATTGGTTATGGCTTAGTTGGGTTACTACTTTTAGGAGCGTTAACTCTTTGGTTT
AATAGCTATCGAAATAACTCACGATATCTTGATTTTGTAGAAGAGAAGCTGCCTGTTGTTCAAAATCATA
GTAACAATATTAAGATCTCTGAAAGCGGCGATGTGTTTAGCATATTGCCATATTTGAGTCTTGTGAAAAA
ACTTCCTAACGGAGAGAATTTCTTAGTTGATGATGCTCCGTTCTCATATGGTTTTGGTCTATATCAAGGC
GGAAAAGTTAAGTCTGCTTCTCGCTCTATATACGACGATGCTATTCATCAAGTATTTGCTCCACAAATTG
CAAAACGCATAGAGAAACGATTAGCAACCATGAGCGATGCAAATATCGTTATTTATTATGAGGCGTTGCG
TGCATATTTAATGATGTATGAACCTGAACATTACGATAAAGATTACTTTACTCAATGGGTTCTTCATGAT
GTAGTAGCTGATAAATCGGCTCAATTTAATAATGAGCAATTCCAGCTTTTAAGAGAACATATGGATTACC
TCTTTGGACAGGGTGCATTTGTATCACCATTTCCACTTAATGAAGAGTTAGTTCAAGAAGCACGAAATCG
TATCGATTCACATGATTTGGCTCAACGTGCGTATCTTCGTGCTCGTGAAATCCTAAAACAAGATCCTAAA
AACGATGTAACTTTGATGACTCTTGCGGGTAATCAAGCATCCACAGTATTTAGACGCAAAAGCGGTGATG
CTTTAAATCGTGGCGTTAATAGAATTTTCTCATACGAAGGGTATTGGAATATTTTTAATAAAAATATTGA
AAAAATATCCATACAATTAAGAGAAGATGACGAGTGGGTATTGGGTATAGATAACACCACATTTGCCGAT
GGTAGTGCAAACAAACTTCTTAATGAGGTTAAAAAACTCTACTTTGTTGATTACATTCGTGAGTGGGATG
CGTTTTTGGCTGATATCGAAGTTATTCCTCCTAAAAATTTAAGTCATGCAATTGAATTGTCCCGTAGTAT
GTCTTCTACCAACTCGCCTCTGACTAAATTCGTTAAAGGAGTAGCGGGTGATACAACCCTTTTACGTGAG
GACGTTAATTTTCAGAGAACTCTTGTAGATAGAGCTACTGAAAGTGCTTCAAGTATGGCTTCTTCATTGA
CATCTTTGATGGGTCCACTTGATACTGGTGATCTCATTAAAGGGAAAGAGGAACCTACCAAATTAGAGTC
TATGGTGGATAATCACTTTATTGGTTATCACGAATTGGCTGTCAGTGCGGGAAATAACACACCTGCACCG
ATTGAGGGGACGATTGACCTAATCGAAGAGTTATATAACTTCTTGACGGCGTCAGAAACAGCTTTGCGGA
CTAAGGTATCATTGCCATCGCAAGAAGTAATTTCAAAACTTCAAGCAGAATCTGGACGTCTACCACCAGT
TGTGGGCAGTATGCTTACATCAATCACAACAGAAGCTTCTAAAGCTATTAACTCTGGAGCTCAAGCGAAT
ATCGGTGCGGATATTAATGCACAGATTGGTATGTCTTGCAGAAACTCTATCACTAACAGATATCCATTTA
GGTCAACCACTCGCGATGTTGCACCTAATGATTTTGCAAGGTTTTTCGCACCAAATGGCTTAATGGATCA
ATTCTTTAATAAGAATTTAATCAATATGGTGGATATGTCTAAGCGTCCATGGCGATTTAAACCAGGGGTG
GATGGCTCGAAAGGGAACATTGCCAAATACTTATCTTCTTTTGAGAAAGCTGCTGTAATTCGTGATGTTT
ATTTTGCAGGCGGCAAACCTGAACCTTCGTTTAAAGTTTCAATACGTCCTGTAGAGATGGATGCAAGCAT
TACGCAAATGGTACTTAATATTGATGGTCAGACATTGACTTATGAGCATGGTCCTCAAGTAGGCAAATCT
TTTGATTGGCCTGGTCAGGGAAGCAATCAAGTTTCAATTACCTTAAGCCCTCATGATGGAACTTCATCTC
TTACAACTAACGGGCCGTGGGCTCTTAATCGACTGATAGATAATGCGAAGATTTCGCGTGGTCGTTCCCC
TGAGGTTATTTTTGCTACATTCAACATAGGTGGTAGATCTGTGAAATTAGAAATCACTGCTAACTCCGCG
AAAAGTCCATTTAGATTGGGCGAGATGCGAAGCTTTGTTTGCCCAGGAGTGAACTAG
 Primer design