SecReT6
Protein ID: 479197088
SecReT6 ID750
T6SS typei3
Gene symbol-
Locus tagKUK_1099
StrainTaylorella equigenitalis 14/56
Repliconchromosome [GenBank: NC_021036] [Browse all T6SS(s) in this replicon]
Location [Strand]1188403..1192029 [+]
Producthypothetical protein
NoteTssM
UniProt IDI7IB93
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.60E-90, Aligned region: 213..478
ImcF-related_N [PF14331], Evalue: 4.60E-90, Aligned region: 1062..1078
IcmF-related [PF06761], Evalue: 1.70E-79, Aligned region: 232..268
IcmF-related [PF06761], Evalue: 1.70E-79, Aligned region: 529..837
DUF1215 [PF06744], Evalue: 7.00E-33, Aligned region: 720..745
DUF1215 [PF06744], Evalue: 7.00E-33, Aligned region: 948..1070
Protein Sequence: 1208 a.a.     [Download]
>gi|479197088|ref|YP_007826457.1| conserved hypothetical protein [Taylorella equigenitalis 14/56]
MFSLINLFITRIFSFLFSRALWSFLGLVILSCLIWFLGPALRVGEFAPLESRDVRMYLIIAIFALYFLRL
FWRKYREGRLNAKLLGQLKSKKPKDNEKLTEKEREEVRVLSERFDEAIALLKQSRFENGKDKSLSARFSK
QYLYQLPWYVFIGAPGSGKTTALVNSGLNFPLAEKFGRMALKGVGGTRNCDWWFTDEAVLLDTAGRYTTQ
DSNTATDEDEWKGFLKLLTKYRARQPINGVMLTVSVYDLLASTQEERAKHAVALKKRLQELRDELGTEFP
VYILVTKMDQLHGFEDYFDNLSVEEHQQVWGFTFPYEESQEEGFSFYDSYEKEFQILQERLFDGLPDLLM
KNRNLESSSLAYLLPQQFANLRIVLGTFLTEVFSFSRLESKIVPRGVYFTSGTQGGVSFDKVSEDLKDYL
QIDGISQHNKAPVLEGGKSYFLTDLLQNLIFKESGLAGVNLKWEKRYRQMQWIGYGLVGLLLLGALTLWF
NSYRNNTRYLDFVEEKLPVLQNHSNNIKISESGDVFSILPYLSLVKKLPNGETFNVEDAPFSYGFGLYQG
GKIKSASRSIYDEAIHQVFAPQIAKRIEKRLATMSDANIVVYYEALRAYLMMYEPEHYDKDYFMQWVLHD
VVADKSAQFNNEQFQLLREHMDYLFGQGAFVSPFPLNEELVQLARDRIDAHDLAERAYNRAREILKQDSK
YDVSLMNLAGVQASTVFRRKSGDALNKGVNRIFSYEGYWNNFNKNIEKIAIQLREDDEWVLGINNTKFAD
GSANKLVNDVKKLYFVDYIREWDAFLADVEVIPPKNLSHAIELSRSMSSSNSPLTKFVKGVAADTTLLRE
DVDFQRTLVDRATESASSMASSLTSLMGPLDTGDLIKGKEEPEKLESMVDNHFIDYHELAVSAGNNQDAP
IEGTIDLIEELYNFLTASETALRTKVTLPSQDVISKLQAESGRLPPVVGNMLTSITAEASKAINSGAQAN
IGADINAQIGMSCRNSITNRYPFRSTTRDVAPNDFARFFAPNGLMDQFFNKHLINMVDMSKHPWRFKPGV
DGSKGNIAKYLSSFEKASVIRDVYFAGGKPEPSFKVSIRPVEMDASITQMVLNIDGQTLTYEHGPQIGKS
FDWPGQGSNQVSITLSPIDGTSSLTTNGPWALNRLIDNAKIKNGRSPEVIFATFNIGGRSVKLEITANSA
KSPFRLGEMRSFTCPGVN
 
Nucleotide Sequence: 3627 bp     [Download]
>gi|479196022|ref|NC_021036.1|:1188403-1192029 Taylorella equigenitalis 14/56 draft genome
ATGTTCAGCCTTATAAATTTGTTTATCACAAGAATTTTTAGTTTTTTGTTTAGTAGAGCTTTGTGGTCAT
TTCTTGGCCTTGTAATTCTTTCTTGTTTGATTTGGTTTTTAGGTCCTGCACTAAGGGTTGGAGAGTTTGC
TCCACTTGAATCTCGTGATGTGAGGATGTACTTAATCATTGCCATCTTTGCACTTTATTTCTTAAGGTTG
TTTTGGAGGAAATATCGAGAAGGACGGCTTAATGCAAAGCTCTTAGGACAACTTAAAAGCAAAAAACCTA
AGGACAATGAAAAACTTACCGAGAAAGAGCGTGAAGAAGTCAGAGTATTATCAGAACGCTTCGATGAGGC
GATTGCACTTTTAAAACAATCCCGATTTGAAAATGGTAAAGACAAATCGTTATCTGCTAGATTTTCTAAA
CAATATCTTTATCAATTGCCTTGGTATGTGTTTATTGGGGCTCCAGGTTCAGGTAAAACTACGGCTTTAG
TAAATTCTGGGCTTAATTTTCCATTGGCAGAGAAATTTGGTCGTATGGCTCTTAAAGGCGTGGGAGGTAC
TCGTAATTGTGATTGGTGGTTTACTGATGAGGCTGTACTTCTGGATACCGCAGGTCGATACACTACACAA
GATAGTAATACTGCGACTGACGAAGATGAGTGGAAGGGGTTCTTAAAACTTCTTACAAAATATCGAGCAA
GGCAGCCGATTAATGGTGTTATGTTGACTGTCAGTGTGTACGACTTGCTTGCTTCAACTCAAGAGGAGCG
TGCGAAACACGCAGTTGCACTTAAAAAACGTCTCCAAGAATTACGCGATGAATTGGGTACAGAGTTTCCT
GTTTATATTCTCGTTACTAAGATGGACCAATTGCATGGTTTTGAGGATTACTTCGATAACCTTAGTGTTG
AGGAGCATCAGCAGGTTTGGGGTTTCACGTTCCCGTATGAAGAGTCTCAAGAGGAGGGATTTAGTTTCTA
CGATTCGTACGAAAAAGAATTCCAAATTCTGCAAGAGCGTTTATTCGACGGGCTTCCAGATTTGTTAATG
AAAAACAGGAATTTAGAAAGCAGTTCATTGGCGTATTTATTGCCACAGCAATTTGCAAATTTAAGAATTG
TACTTGGCACTTTCCTAACCGAAGTTTTCTCATTTAGTCGCTTGGAATCTAAAATTGTTCCACGTGGCGT
TTACTTCACTAGCGGAACTCAGGGTGGTGTTAGTTTCGATAAAGTTAGTGAGGACTTAAAAGATTATCTG
CAAATCGACGGCATTTCTCAGCACAACAAAGCACCTGTGCTTGAGGGCGGAAAAAGCTATTTCCTAACCG
ACCTACTTCAAAATTTAATTTTCAAGGAATCAGGTTTAGCTGGTGTGAATCTGAAGTGGGAGAAGCGTTA
TCGTCAAATGCAGTGGATTGGGTATGGTTTAGTTGGGTTGCTTTTGCTAGGAGCCTTAACTCTTTGGTTT
AATAGCTACCGCAATAACACTAGATATCTTGATTTTGTGGAAGAAAAGTTGCCAGTACTTCAAAATCATA
GTAACAACATTAAAATTTCTGAAAGTGGTGATGTTTTCAGTATATTGCCTTACCTCAGTTTAGTTAAAAA
GCTTCCAAACGGTGAGACTTTCAATGTTGAGGATGCTCCGTTTTCTTATGGCTTTGGTTTGTACCAGGGT
GGCAAAATTAAATCAGCTTCGCGCTCTATATACGATGAGGCTATTCATCAGGTTTTTGCACCTCAGATAG
CTAAAAGAATTGAAAAACGTTTAGCCACAATGAGCGATGCAAATATCGTTGTTTATTACGAGGCTTTACG
TGCTTATTTAATGATGTATGAACCCGAACACTACGATAAAGACTACTTTATGCAGTGGGTGCTTCATGAT
GTAGTAGCCGATAAATCTGCTCAATTCAATAACGAACAGTTCCAGTTACTTCGTGAGCATATGGATTATT
TATTTGGACAGGGTGCTTTTGTATCTCCATTCCCATTAAATGAGGAATTAGTGCAGTTGGCACGTGACCG
TATAGATGCTCATGACTTAGCTGAACGTGCCTACAATCGAGCAAGAGAAATTCTAAAACAAGATTCAAAA
TACGATGTATCACTTATGAACCTTGCTGGGGTGCAGGCCTCCACAGTATTCCGTCGTAAAAGTGGTGATG
CTTTGAATAAAGGTGTAAATAGAATTTTCTCTTATGAGGGATATTGGAATAACTTCAATAAAAATATTGA
AAAGATTGCCATCCAACTTAGAGAAGATGATGAGTGGGTTCTCGGGATTAACAACACAAAATTTGCTGAT
GGCAGTGCAAACAAACTTGTTAATGATGTAAAAAAACTCTACTTTGTAGACTATATCAGGGAGTGGGATG
CCTTCTTAGCGGATGTGGAAGTAATTCCACCTAAAAATTTAAGTCATGCAATTGAGCTTTCTCGCAGTAT
GTCATCATCTAATTCACCTCTTACAAAATTTGTTAAGGGTGTAGCTGCAGACACAACATTGCTTCGTGAG
GATGTTGACTTTCAAAGAACATTGGTTGATAGGGCTACAGAAAGTGCCTCAAGTATGGCATCTTCGCTAA
CTTCCTTGATGGGACCTCTTGATACGGGTGACCTTATTAAGGGTAAAGAAGAGCCTGAAAAACTTGAGTC
CATGGTTGATAACCACTTTATCGATTACCATGAGTTAGCTGTCAGTGCTGGCAATAACCAAGATGCGCCT
ATTGAAGGCACTATTGACTTAATCGAGGAGTTATACAATTTCTTGACGGCTTCTGAGACCGCACTTAGGA
CCAAAGTAACATTGCCATCCCAAGATGTTATTTCTAAGCTTCAGGCTGAATCAGGTCGTTTACCACCTGT
TGTGGGTAACATGCTTACTTCGATTACTGCAGAAGCTTCAAAAGCGATTAACTCTGGAGCACAAGCCAAT
ATCGGTGCGGATATTAATGCACAGATAGGTATGTCTTGCAGGAACTCGATTACAAACAGATATCCATTTA
GATCTACTACTAGGGATGTGGCTCCTAATGATTTTGCTAGATTCTTTGCACCAAATGGTTTGATGGATCA
ATTCTTTAATAAGCACTTAATCAATATGGTGGATATGTCCAAACATCCATGGCGTTTTAAACCAGGTGTA
GACGGCTCAAAAGGGAATATTGCCAAATATCTTTCTTCTTTCGAAAAAGCATCTGTAATTCGTGATGTTT
ATTTTGCTGGTGGCAAACCTGAACCTTCTTTTAAAGTGTCTATTAGGCCAGTTGAGATGGATGCAAGTAT
AACTCAGATGGTTCTTAATATTGATGGTCAAACTCTGACTTATGAACACGGTCCACAAATTGGTAAGTCG
TTTGATTGGCCAGGTCAGGGAAGCAATCAAGTTTCAATTACTCTTAGCCCGATTGATGGAACATCATCCT
TGACGACAAATGGTCCATGGGCTTTAAACCGTCTTATCGATAATGCAAAAATTAAAAATGGTCGCTCGCC
TGAAGTAATTTTCGCAACGTTTAATATTGGGGGACGTTCTGTGAAACTTGAAATCACAGCCAATTCCGCT
AAGAGCCCGTTCAGACTTGGCGAGATGCGCAGTTTTACTTGCCCAGGAGTTAACTAA
 Primer design