SecReT6
Protein ID: 479271505
SecReT6 ID751
T6SS typei3
Gene symbol-
Locus tagENC_07180
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]749102..749605 [+]
Producttype VI secretion lipoprotein, VC_A0113 family
NoteTssJ
UniProt IDD6DQD7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.20E-29, Aligned region: 19..141
Protein Sequence: 167 a.a.     [Download]
>gi|479271505|ref|YP_007844784.1| type VI secretion lipoprotein, VC_A0113 family [Enterobacter cloacae subsp. cloacae NCTC 9394]
MNNKNFHRMWFPFFALIFALIGGCTSSSHSDPSRYNLQFQAHPQINDSAPLKVRVLLLKSDADFMSSDFY
SLQNNASATLGANLLNSDVFFLMPGQLSKTLSGQSSPEARYIGVMAEYQALDGKKWRVSLPLPVPGENAI
YQFWKWSADELQASVFLDVNGIRVISQ
 
Nucleotide Sequence: 504 bp     [Download]
>gi|479270911|ref|NC_021046.1|:749102-749605 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGAATAATAAAAATTTTCATCGGATGTGGTTCCCTTTTTTTGCGTTGATTTTCGCGCTGATCGGTGGTT
GTACGTCGTCTTCACACAGCGACCCCTCCCGCTACAATCTTCAGTTTCAGGCTCATCCTCAAATCAATGA
TTCTGCGCCGCTTAAGGTCAGAGTGTTGCTGCTGAAATCCGATGCGGATTTCATGTCCAGTGACTTCTAC
TCCTTACAGAACAACGCGTCAGCCACGCTTGGCGCGAATCTGCTGAACAGCGATGTGTTCTTCCTGATGC
CGGGCCAGCTTTCGAAAACCCTGAGCGGACAAAGCTCACCGGAAGCGCGCTATATCGGCGTGATGGCGGA
ATACCAGGCGCTGGACGGCAAAAAATGGCGCGTCTCACTTCCTTTGCCTGTTCCCGGCGAAAACGCGATT
TACCAGTTCTGGAAATGGTCCGCAGATGAACTCCAGGCCAGCGTCTTTCTTGACGTAAATGGTATCCGGG
TCATCAGCCAGTAA
 Primer design