SecReT6
Protein ID: 479271506
SecReT6 ID751
T6SS typei3
Gene symbol-
Locus tagENC_07190
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]749634..750977 [+]
Producttype VI secretion protein, VC_A0114 family
NoteTssK
UniProt IDD6DQD8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.20E-139, Aligned region: 19..443
Protein Sequence: 447 a.a.     [Download]
>gi|479271506|ref|YP_007844785.1| type VI secretion protein, VC_A0114 family [Enterobacter cloacae subsp. cloacae NCTC 9394]
MTKAEKVVWTEGMFLRPHHFQRTESYLLNHVREWGALQRSYLWGFLDLELDEAMLRQGCIALSYCSGLLP
DGTFFQVRSDRNGPAPLKIPDNLTNEKVVLALPVRRGGREEVIFSEEQSSLARFITFEQEVEDDNAMSVG
EATVQFGRLRLTLMLEKDLTAEWTAIGVAYVTEKRNDNHVRLDNSYIPPMLNANNSPQLYGMINDLHGLL
VQRSQQIGGRLRQPGRFNTSEMVEFTLLSLINRHLGDVSHLKTLPLLHPEALWRSWLPFATELATWTPQR
TAESILPVYDHDDLAVCFSKLMLMLRQGLSLVMEDHAIQLPLHERSHGLNIATVPETSMVREFGFVLAVK
ANVPGEHLQTHFPAQMKVAPVSKIRDLVQLQLPGIMLRAMPVAPPQIPWHAGYSYFELERGSELWHEMDK
SGAFALHLAGEFPGLDMEFWAIRSPTE
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|479270911|ref|NC_021046.1|:749634-750977 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGACGAAAGCAGAAAAGGTCGTCTGGACCGAGGGCATGTTCCTGCGTCCCCACCATTTTCAGCGGACAG
AAAGCTACCTCCTCAACCACGTTCGTGAGTGGGGGGCCTTGCAGCGATCGTATCTTTGGGGCTTTCTCGA
CCTTGAGCTGGATGAAGCGATGCTTCGCCAGGGCTGTATTGCCCTGAGCTACTGTAGCGGTTTGCTGCCT
GACGGCACCTTTTTCCAGGTTCGCAGCGACCGCAACGGTCCGGCTCCGCTAAAAATCCCCGATAATCTGA
CCAATGAAAAGGTGGTGCTTGCGCTGCCGGTTCGTCGCGGTGGCCGTGAAGAGGTGATTTTCAGCGAGGA
GCAGTCTTCTCTGGCGCGTTTTATTACCTTTGAACAAGAGGTGGAAGACGACAACGCCATGTCGGTCGGG
GAGGCGACGGTCCAGTTTGGCCGCCTGCGTCTGACCCTGATGCTGGAGAAAGATCTGACGGCAGAATGGA
CCGCCATCGGCGTGGCGTACGTCACCGAAAAGCGCAACGACAACCACGTGCGGCTGGATAACAGCTACAT
TCCGCCAATGCTGAACGCCAATAACAGCCCGCAGCTGTACGGCATGATCAATGACCTGCACGGCTTGCTG
GTGCAGCGTAGCCAGCAGATCGGCGGTCGACTGCGCCAGCCGGGGCGTTTCAATACGTCTGAAATGGTTG
AGTTCACGCTTCTCTCGCTGATCAACCGCCACCTTGGCGACGTCTCACATTTAAAAACGCTGCCGCTGCT
TCACCCGGAAGCGCTCTGGCGCAGCTGGCTGCCGTTCGCCACGGAGCTCGCCACCTGGACGCCGCAGCGT
ACCGCAGAGAGCATACTGCCGGTATACGACCATGACGATCTCGCCGTTTGCTTCAGCAAACTGATGCTGA
TGCTGCGTCAGGGGCTGTCGCTGGTCATGGAAGATCATGCCATCCAGCTGCCGCTGCACGAACGCTCCCA
CGGGCTGAACATCGCCACCGTGCCGGAGACCAGCATGGTCCGTGAATTTGGCTTTGTGCTGGCGGTAAAA
GCCAATGTCCCCGGCGAACACCTGCAAACCCATTTCCCTGCCCAGATGAAGGTTGCGCCAGTGTCGAAAA
TTCGCGATCTGGTTCAGCTTCAACTGCCGGGCATCATGCTTCGGGCAATGCCCGTCGCGCCGCCGCAGAT
CCCGTGGCATGCAGGCTACAGCTATTTCGAGCTCGAGAGGGGCAGCGAACTGTGGCACGAGATGGACAAG
TCCGGGGCATTCGCGCTGCATCTCGCAGGGGAATTCCCGGGTCTCGATATGGAGTTCTGGGCCATCCGTA
GCCCGACAGAATAA
 Primer design