SecReT6
Protein ID: 479271507
SecReT6 ID751
T6SS typei3
Gene symbol-
Locus tagENC_07200
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]750995..752233 [+]
Producttype IV / VI secretion system protein, DotU family
NoteTssL
UniProt IDD6DQD9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.10E-68, Aligned region: 20..225
DUF2077 [PF09850], Evalue: 1.10E-68, Aligned region: 367..389
OmpA [PF00691], Evalue: 4.80E-14, Aligned region: 290..388
Protein Sequence: 412 a.a.     [Download]
>gi|479271507|ref|YP_007844786.1| type IV / VI secretion system protein, DotU family [Enterobacter cloacae subsp. cloacae NCTC 9394]
MQERQDTGSDAVFTGASGNNQLVAAANPLLNAIPQIRHSVSHDDQVGLRQRLIDEIRRFEVRCQQAGLPY
EVIVGARYCLCTALDEAAALTPWGSSGVWSSNGLLVTFHNETWGGEKFFQLLARLSQNPREHILLLEMIN
YCLLLGFEGRYRVLDNGRTQLETIKQRLWQMIRGVRGSYPPPLSPHPEDRPVLRKLWRPMIPLWACVALV
GFIACLFYIVLNWRLGDNTSPVLAKIYQSQLPETTIQQPARQLPAVLNLRGFLKPEIDAGLVAVKDEADR
SVVILKGDGLFASASTVVRDRYEPVIDRIAQAMNNVSGKILVVGYSDNVPIRSARFASNYELSLERARSV
QKQLQGSLSQPERVKAEGRGEINPVAPNTTPENRARNRRVEITLLVSPDNTQAELNGLPQGN
 
Nucleotide Sequence: 1239 bp     [Download]
>gi|479270911|ref|NC_021046.1|:750995-752233 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGCAGGAACGACAGGATACCGGCAGTGATGCCGTGTTTACCGGAGCCAGTGGGAACAATCAGCTGGTGG
CGGCCGCCAATCCGCTGCTCAATGCGATTCCGCAAATCCGTCATTCGGTTTCCCACGACGATCAGGTCGG
GCTGCGCCAGCGCCTGATTGACGAAATTCGCCGTTTCGAAGTGCGATGCCAGCAGGCGGGCTTACCGTAT
GAAGTGATTGTCGGCGCGCGCTACTGCCTCTGCACGGCGCTGGACGAAGCCGCCGCGCTGACCCCGTGGG
GAAGCAGCGGCGTCTGGTCAAGCAATGGTCTGCTGGTGACGTTTCATAACGAAACCTGGGGCGGTGAGAA
GTTTTTCCAGCTGCTGGCGCGTCTGTCGCAGAATCCGCGCGAACACATTCTGCTGCTGGAGATGATCAAC
TACTGTCTGCTGCTCGGCTTTGAAGGCCGCTACCGCGTGCTGGACAATGGCCGGACCCAGCTTGAAACCA
TTAAACAGCGCCTGTGGCAGATGATCCGTGGCGTGCGCGGCAGCTACCCGCCGCCGCTCTCGCCGCACCC
GGAAGATCGCCCCGTTCTGCGCAAGCTCTGGCGGCCGATGATCCCTCTTTGGGCGTGCGTGGCGCTGGTC
GGCTTTATCGCCTGCCTGTTCTATATCGTGCTGAACTGGCGTCTGGGTGATAACACCAGCCCGGTGCTGG
CGAAAATTTACCAGTCCCAACTGCCGGAAACCACGATCCAGCAGCCTGCGCGTCAGCTGCCGGCGGTGCT
GAACCTGCGCGGCTTCCTGAAACCAGAAATTGATGCCGGTCTGGTGGCCGTTAAGGATGAGGCGGATCGC
AGCGTGGTGATCCTGAAAGGGGACGGACTCTTTGCCTCGGCCTCAACGGTGGTGCGCGATCGCTATGAGC
CGGTCATCGACCGCATCGCCCAGGCGATGAATAACGTCAGCGGCAAAATTCTGGTGGTGGGGTACAGCGA
CAACGTGCCGATCCGCAGCGCACGCTTCGCCTCCAACTATGAACTCTCGCTTGAGCGCGCCCGTTCGGTG
CAAAAACAGCTCCAGGGTAGCCTCTCACAGCCTGAGCGTGTCAAAGCCGAAGGGCGGGGTGAGATCAACC
CGGTAGCGCCTAACACCACGCCTGAAAATCGCGCCCGTAACCGCCGCGTAGAGATTACGCTGCTGGTATC
GCCTGACAATACCCAGGCCGAGCTGAACGGATTGCCGCAAGGAAACTAA
 Primer design