SecReT6
Protein ID: 479271508
SecReT6 ID751
T6SS typei3
Gene symbol-
Locus tagENC_07210
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]752236..755856 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDD6DQE0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.00E-99, Aligned region: 208..483
ImcF-related_N [PF14331], Evalue: 3.00E-99, Aligned region: 760..792
IcmF-related [PF06761], Evalue: 4.50E-91, Aligned region: 531..835
DUF1215 [PF06744], Evalue: 2.90E-29, Aligned region: 947..1071
AAA_16 [PF13191], Evalue: 0.0062, Aligned region: 142..266
AAA_16 [PF13191], Evalue: 0.0062, Aligned region: 762..862
Protein Sequence: 1206 a.a.     [Download]
>gi|479271508|ref|YP_007844787.1| type VI secretion protein IcmF [Enterobacter cloacae subsp. cloacae NCTC 9394]
MLTTLLSILTNRILWSFLGVTALAAVIWMIGPLLSIVDTRPLESEQNRVISIAVVYLIWAQSHILPRLYN
AWLNRKLMDKLNENTTSPEAADPQKRLNSEEQILAGRFDEAAQMLKKAHFSKAGHGAQWTQRFSTQYLYQ
LPWYVIIGAPGSGKTTALANSGLQFPLADRFGKTALRGIGGTRNCDWWFTNEAVLLDTAGRYTTQESEQV
QDAGEWLEFINLLRKYRRRQPINGVIITISISDLLSQSAEASRQQAVNLRQRLSELHEQLGIRFPVYVMV
TKADLLKGFRAWFADYDKAQRDQIWGFTLPWEQTKHADYDLMGNFQQEFSLLQQRLDAGLPETMLKEHDA
KTRAEAYLFPQEFTALRPLLADYLSTVFARSNFETEFSPRGIYFASGTQEGMPFDRVMGELNRALSLPEG
GESTRWDSVSKEAPIPGAKGQSFFIKNLLQNVIFQEAGIAGENRWWELRNRAVMWSGYAALLALLVILGG
LWLTSYAKNKAYLEEVDAKVPMLEQQSKALQNQPQRDLFALLPLLNSLVDLPKSNAFDVNDPPVSRRMGL
YRGDDVSDASQSLYQKALDQMLLPAVAMHITTWLRNDNGSDVEYSYEALKAYQMLYQPKHYDGKFLHSWV
MLNLQRNLPQNVTQAQLQELEWHLTQLLEPKIQASPYAQDEDLVARERALINQQPLSTRVYGRLKRLLEH
DENLKPVSLSDLGGPQSELVFSRKSGKPVSEGVPGLYTPDGYWKSFNDQIDSVTTALHEDDAWVLGATTA
QEDKQQIDNAVRQLYMRDFIVNWDRFLADIQLNNSADLSQRINTARLLSGTNSPLRRLVLNLSKVLTLSR
TAPAPEDAQKAEDQSNRATRTLEALFSNGDNAPTQGAVVTQAPEQLVTDHYAPMIELAQPLEKGGKTIVF
DDFLKQVDELYRYLTAVQDAANSGMPAPGGDAISRLQASAGRLPGGLQTMFSNMAVGASSDTQRRDLENV
RKRINVEVGGFCRQAIAGRYPLVRSASTEVTPDDLARMFAPGTGLMDTFFRDNLTNKVDTTQANWRFMPG
IDGKTLPGSEGLLRPFQQAQSVRDAFFANGATTPSFKVTVRTVRMDNTILNLTLDVDGQLLRYSHGPQAV
QIMNWPGPGGTNQVRMQLGLTNGSTATLVTNGSWALNRFFDKARTSPGAGSLSRQATFNVDGHQVTLEFA
PNSIRNPFQLPRFSCP
 
Nucleotide Sequence: 3621 bp     [Download]
>gi|479270911|ref|NC_021046.1|:752236-755856 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGCTGACAACTCTACTTTCTATACTGACCAATCGCATTCTGTGGAGCTTCCTGGGCGTAACGGCGCTCG
CGGCGGTCATCTGGATGATTGGCCCGCTGTTGTCCATCGTGGATACCCGGCCCCTTGAATCAGAGCAGAA
CCGCGTCATCAGCATTGCGGTGGTCTACCTGATTTGGGCCCAGAGCCACATTCTGCCGCGGCTGTATAAC
GCCTGGCTGAACCGTAAGCTGATGGACAAGCTCAACGAAAATACCACCAGCCCGGAGGCGGCCGATCCGC
AGAAACGGCTGAACAGCGAGGAGCAGATCCTTGCCGGGCGTTTCGATGAAGCCGCCCAGATGCTGAAAAA
AGCCCACTTCAGCAAAGCGGGACATGGCGCGCAGTGGACGCAGCGCTTCAGCACGCAGTACCTCTATCAG
CTGCCGTGGTACGTCATTATTGGCGCGCCGGGTTCCGGTAAAACCACCGCGCTGGCCAACTCCGGGCTGC
AATTCCCGCTGGCGGACCGCTTCGGTAAAACCGCGCTGCGCGGCATTGGCGGCACGCGCAACTGTGACTG
GTGGTTCACCAACGAGGCGGTTCTGCTGGATACCGCGGGGCGCTATACCACTCAGGAGAGTGAGCAGGTT
CAGGACGCCGGGGAGTGGCTGGAATTTATCAACCTGCTGCGTAAATACCGCCGTCGCCAGCCCATCAACG
GCGTGATTATCACCATCAGCATTTCCGACCTGCTTTCGCAGTCCGCTGAGGCCTCGCGCCAGCAGGCGGT
CAACCTGCGCCAGCGTCTCTCCGAGCTGCATGAACAGCTGGGTATTCGCTTCCCGGTGTATGTGATGGTG
ACCAAAGCGGACCTGCTTAAAGGCTTCCGCGCCTGGTTTGCTGATTACGACAAAGCCCAGCGCGACCAGA
TCTGGGGCTTTACGCTGCCGTGGGAGCAGACCAAACACGCCGATTACGACCTGATGGGCAACTTCCAGCA
GGAATTTTCCCTGCTGCAACAGCGTCTGGATGCTGGCCTTCCGGAAACCATGCTCAAAGAGCATGACGCC
AAAACCCGTGCGGAAGCCTATCTCTTCCCGCAGGAGTTCACCGCGCTGCGTCCGCTGCTGGCTGACTACC
TGAGCACGGTCTTTGCCCGTTCAAACTTCGAAACCGAATTTTCGCCGCGTGGCATCTACTTTGCCAGCGG
CACTCAGGAAGGGATGCCGTTTGACCGCGTGATGGGCGAGCTGAATCGCGCGCTCTCCTTACCTGAAGGG
GGGGAAAGCACGCGCTGGGATTCGGTGAGCAAAGAGGCGCCGATCCCAGGCGCGAAGGGCCAAAGCTTCT
TCATTAAAAACCTGCTGCAAAACGTCATTTTCCAGGAAGCGGGCATCGCCGGGGAAAACCGCTGGTGGGA
GCTGCGCAACCGCGCCGTGATGTGGTCCGGCTACGCGGCGCTGCTGGCCCTGCTGGTGATCCTGGGTGGC
CTGTGGCTGACCAGCTACGCCAAGAATAAAGCCTATCTGGAAGAAGTGGATGCAAAAGTGCCGATGCTGG
AGCAGCAGAGCAAGGCGCTGCAAAACCAGCCCCAGCGCGATCTGTTTGCGCTTCTGCCGCTGCTTAACAG
CCTGGTGGATCTGCCGAAAAGCAATGCCTTCGACGTTAACGACCCGCCGGTTTCCCGCCGCATGGGGCTT
TATCGCGGGGATGACGTCAGCGATGCCTCGCAGTCTCTGTACCAGAAGGCGCTGGATCAGATGCTGCTGC
CCGCCGTGGCGATGCACATTACCACCTGGCTGCGCAACGACAACGGCAGCGACGTGGAGTACAGCTATGA
GGCGCTGAAAGCCTATCAGATGCTCTACCAGCCGAAGCACTATGACGGCAAATTCCTGCACTCGTGGGTG
ATGCTCAACCTGCAACGCAACCTGCCGCAGAACGTGACGCAGGCGCAGCTTCAGGAGCTGGAATGGCACC
TGACCCAGCTGCTGGAGCCAAAAATTCAGGCTTCACCGTATGCGCAGGATGAGGATCTGGTGGCCCGTGA
AAGGGCGCTCATCAACCAGCAGCCGCTCTCAACACGCGTCTATGGCCGCCTGAAACGTCTGCTGGAGCAT
GATGAAAACCTGAAGCCGGTTTCGCTTTCAGATCTCGGCGGCCCGCAGAGCGAGCTGGTGTTTTCCCGTA
AAAGCGGCAAGCCGGTGAGTGAGGGCGTACCGGGTCTGTATACGCCGGACGGCTACTGGAAGAGCTTCAA
CGACCAGATCGACAGTGTGACCACCGCCCTGCACGAGGACGACGCCTGGGTACTGGGAGCGACCACCGCT
CAGGAAGATAAACAGCAGATCGACAACGCCGTGCGCCAGCTCTACATGCGCGACTTTATCGTCAACTGGG
ATCGCTTTCTCGCTGACATTCAGCTCAACAACAGCGCCGATCTTTCCCAGCGTATTAACACCGCGCGCCT
GCTTTCAGGCACCAACTCGCCGCTGCGCCGTCTGGTGCTTAACCTGAGCAAGGTGCTGACCCTGTCGCGC
ACTGCGCCTGCGCCGGAAGATGCGCAGAAAGCGGAAGACCAAAGCAACCGCGCCACCCGCACGCTGGAAG
CGCTGTTCAGCAACGGTGACAATGCCCCGACGCAAGGCGCGGTCGTGACGCAGGCGCCTGAGCAACTGGT
GACCGACCACTATGCGCCGATGATTGAGCTGGCGCAGCCGCTGGAGAAGGGTGGCAAGACCATCGTCTTT
GACGATTTTCTTAAGCAGGTTGACGAGCTTTATCGCTACCTGACCGCCGTTCAGGATGCGGCAAACAGCG
GTATGCCCGCGCCGGGTGGGGATGCAATCAGCCGCCTGCAAGCCAGCGCGGGCCGTCTGCCGGGCGGGCT
GCAAACCATGTTCAGCAATATGGCCGTCGGCGCCAGCAGCGACACCCAGCGTCGCGATCTGGAGAACGTG
CGTAAGCGCATTAACGTGGAAGTGGGTGGGTTCTGCCGTCAGGCGATTGCCGGGCGTTATCCACTGGTGC
GCAGCGCCAGCACCGAGGTGACGCCGGACGATCTCGCCCGCATGTTCGCGCCGGGCACCGGACTGATGGA
CACCTTTTTCCGCGACAACCTGACCAACAAGGTGGACACTACCCAGGCGAACTGGCGCTTTATGCCGGGC
ATCGACGGTAAAACGCTGCCGGGCAGCGAAGGGCTGTTGCGTCCGTTCCAGCAGGCGCAGTCTGTCCGCG
ATGCCTTCTTTGCCAACGGCGCGACCACGCCATCCTTTAAGGTCACGGTGCGCACCGTGCGGATGGACAA
CACCATTCTGAACCTGACGCTGGACGTGGACGGCCAGCTGCTGCGCTACAGCCACGGTCCGCAGGCGGTG
CAGATCATGAACTGGCCGGGGCCGGGCGGGACGAACCAGGTGCGTATGCAGCTCGGTCTGACCAATGGCA
GCACCGCAACGCTGGTAACTAACGGTTCCTGGGCGCTCAACCGCTTTTTCGACAAGGCGCGCACCAGCCC
TGGCGCGGGTAGCCTGAGCCGTCAGGCGACCTTCAACGTCGACGGACATCAGGTCACGCTGGAGTTTGCC
CCGAACAGCATCCGCAACCCGTTCCAGCTTCCCCGTTTCTCATGCCCATAA
 Primer design