SecReT6
Protein ID: 479271510
SecReT6 ID751
T6SS typei3
Gene symbol-
Locus tagENC_07230
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]756601..757617 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDD6DQE2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.40E-21, Aligned region: 52..111
Protein Sequence: 338 a.a.     [Download]
>gi|479271510|ref|YP_007844789.1| type VI secretion-associated protein, ImpA family [Enterobacter cloacae subsp. cloacae NCTC 9394]
MNIDEFLAPISPDNPCGENLEYDADFQAMGQASQGKAEQQFGDTIIPAEPADWNTVEKLATSLLGRTKDL
RVMLALTHAWTRRRGLAGYADGLLLVQEALSRYWEQLYPLLEEYGETDPFYRINALAGLSDKSDLTVAVR
NASLLRSNGDEISLRDAQALLDGSKTECPDYPGGRPRLIDELARGDQPGTEAVIVINERLLAIRELLTGY
LGESGVPEMEQLLKTVGLVSSACQVTDISKLLPNRDAQAEQHAEPQPVAASPVQQVTDWRSVQVTSRADA
QLMLEKAKQYFAQYEPSHPAPLMIERVQRLSELNFMDIIRDLAPDGVNQLENIFGRRE
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|479270911|ref|NC_021046.1|:756601-757617 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGAATATCGATGAATTTCTCGCGCCGATAAGCCCCGATAACCCCTGCGGTGAAAACCTGGAGTACGACG
CTGATTTCCAGGCCATGGGTCAGGCCAGTCAGGGCAAAGCCGAGCAGCAGTTTGGCGACACCATCATTCC
GGCAGAGCCTGCCGACTGGAACACGGTGGAAAAACTCGCCACCAGCCTGCTGGGTCGCACCAAAGATCTT
CGCGTCATGCTGGCGTTAACCCATGCCTGGACGCGTCGTCGCGGTCTGGCAGGTTACGCCGACGGGCTAC
TGCTGGTGCAGGAAGCCCTGTCCCGTTACTGGGAGCAACTTTACCCTCTGCTGGAAGAGTATGGCGAAAC
CGATCCATTCTACCGCATCAACGCCCTCGCCGGGCTGAGTGATAAATCTGACCTGACGGTCGCGGTGCGT
AACGCCTCACTGCTCCGCTCAAACGGCGATGAGATTTCGCTCCGTGACGCCCAGGCGCTGCTTGACGGCA
GTAAAACCGAGTGTCCGGATTATCCGGGCGGTCGTCCACGGCTGATCGATGAGCTGGCCCGGGGCGATCA
GCCCGGCACCGAAGCGGTAATCGTGATCAACGAACGCCTGCTGGCCATCCGCGAACTGCTTACCGGCTAT
CTCGGGGAAAGTGGCGTCCCGGAGATGGAACAGCTGCTGAAAACTGTCGGACTGGTTTCCAGCGCCTGTC
AGGTGACCGATATCAGCAAGCTGCTGCCGAACCGTGACGCGCAGGCTGAACAGCACGCCGAGCCGCAGCC
GGTGGCCGCGTCGCCCGTTCAGCAGGTGACGGACTGGCGCAGCGTGCAGGTGACCAGCCGCGCCGACGCC
CAGCTGATGCTGGAAAAAGCGAAGCAGTATTTTGCGCAGTACGAACCCAGCCATCCCGCACCGCTGATGA
TTGAACGGGTGCAGCGGCTGTCTGAACTCAACTTTATGGACATTATTCGCGACCTGGCGCCAGACGGCGT
TAACCAACTGGAAAACATCTTTGGACGCCGCGAATGA
 Primer design