SecReT6
Protein ID: 479271511
SecReT6 ID751
T6SS typei3
Gene symbol-
Locus tagENC_07240
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]757681..758190 [+]
Producttype VI secretion protein, VC_A0107 family
NoteTssB
UniProt IDD6DQE3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-54, Aligned region: 15..144
Protein Sequence: 169 a.a.     [Download]
>gi|479271511|ref|YP_007844790.1| type VI secretion protein, VC_A0107 family [Enterobacter cloacae subsp. cloacae NCTC 9394]
MENIMAMSNSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMADLVGKPVENLPAVDERKFLEID
IDNFDERMKALKPRVAFQVDNTLTGEGKLNVDLTFDSMDDFLPDAVARKVEPLNKLLEARTQLSNLLTYM
DGKNGSGRADRENSPGSDAAQIPEPVAKK
 
Nucleotide Sequence: 510 bp     [Download]
>gi|479270911|ref|NC_021046.1|:757681-758190 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGGAGAACATCATGGCAATGAGTAACAGTGGACAGAAATTCATCGCACGCAACCGTGCTCCCCGCGTGC
AGATCGAGTACGACGTAGAGATCTACGGCGCAGAACGCAAAATTCAGCTGCCGTTTGTGATGGGCGTTAT
GGCCGATCTGGTTGGCAAGCCGGTGGAAAATCTGCCAGCCGTCGACGAGCGTAAGTTCCTGGAAATCGAC
ATCGACAACTTCGACGAACGCATGAAGGCGCTGAAGCCGCGCGTGGCGTTCCAGGTGGATAACACCCTGA
CCGGCGAAGGTAAGCTCAATGTCGATCTGACCTTCGACAGCATGGACGACTTCCTGCCGGACGCGGTGGC
CCGCAAAGTAGAGCCGCTGAACAAGCTGCTGGAAGCCCGTACCCAGCTCTCCAACCTGCTGACCTACATG
GACGGTAAAAACGGTAGCGGAAGAGCTGATCGCGAAAATTCTCCAGGATCCGACGCTGCTCAAATCCCTG
AGCCAGTTGCCAAAAAATGA
 Primer design