SecReT6
Protein ID: 479271512
SecReT6 ID751
T6SS typei3
Gene symbol-
Locus tagENC_07260
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]760431..760913 [+]
Producttype VI secretion system effector, Hcp1 family
NoteTssD
UniProt IDD6DQE4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.20E-38, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|479271512|ref|YP_007844791.1| type VI secretion system effector, Hcp1 family [Enterobacter cloacae subsp. cloacae NCTC 9394]
MAIDMFLKVEGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVNALIDKSTTAIL
KHCASGKHLTKVELSVCKAGGQQVEYTRITLEDVLVTSVQYTGADNGDTVGVTYAFQAAKVKQQYWEQTT
AGGKGAESSAGWNIKENKEA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|479270911|ref|NC_021046.1|:760431-760913 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGGCTATTGATATGTTTCTGAAGGTCGAGGGTGTTACGGGCGAATCTAAAGATTCTAACCACACCGGCT
GGACTGATATTACCTCCTTCTCCTGGGGCGCGTCCCAGCCAGGTAATATGAGCGTTGGCGGTGGCGGCGG
TGCCGGTAAAGTGAACTTTAACGATCTGCACGTTAACGCTCTGATCGACAAATCCACTACAGCAATCCTG
AAACACTGCGCAAGCGGTAAACACCTGACCAAAGTTGAACTGTCCGTCTGCAAAGCGGGTGGTCAGCAGG
TTGAATACACCCGCATCACCCTGGAAGACGTTCTCGTGACTTCCGTTCAGTACACGGGTGCAGACAACGG
CGATACCGTTGGCGTGACCTATGCATTCCAGGCTGCGAAAGTGAAACAGCAGTACTGGGAGCAGACCACT
GCCGGTGGTAAAGGTGCTGAAAGCAGCGCTGGCTGGAACATCAAAGAAAACAAAGAAGCGTAA
 Primer design