SecReT6
Protein ID: 479271515
SecReT6 ID751
T6SS typei3
Gene symbol-
Locus tagENC_07290
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]762479..764254 [+]
Producttype VI secretion system FHA domain protein
NoteFha
UniProt IDD6DQE7
KEGG IDeclo:ENC_07290
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.00E-09, Aligned region: 27..93
UreE_N [PF02814], Evalue: 0.0033, Aligned region: 28..49
UreE_N [PF02814], Evalue: 0.0033, Aligned region: 78..99
Protein Sequence: 591 a.a.     [Download]
>gi|479271515|ref|YP_007844794.1| type VI secretion system FHA domain protein [Enterobacter cloacae subsp. cloacae NCTC 9394]
MRFTIISTKPGHQPPQSSCDFYAPGGTIGRGTDNNLVLPDNDRTISRLQAIVHVDASGECRVTNRGSVTR
VVLNDIPLERGRQVELQDGDILGIDDYRIEVSELIHDTQPVSRMAASMQQARPVATPAPAPQPKPASAAP
RGKAEPTAVPSEIWDSLMQEFSISDSISSNRAKPQPAASHDPFSQPAAPERNAEDPLAMFNDAEPSLERK
NVDPDTLFSDEALFKKESIFDDVTPSTLVQPDESKPAQPKEEASDELDPLALFGGSASAPAARHDDPLGL
MGGAPLTHPDEIVADKPEPKPEPQAAQEEDALASSPLFDPEPTEPQDAPRAEEEPARPDYAGFTMPTPQA
VARSNAQAPKGRLRIDPVKNAASPAASAQTGERGEVLQGELLEALLEGMGLSEMQPVPQFDRENMRQLGQ
ILGMFSQGTVALLSSRSILKRGVKADMTMVLDDANNPFKLLPTGKTVLIQMFGTPMPGFMPPTKSVRDAL
IDLQAHQLGMISGIRAIIAAMLQSFNPEQLEEQAKQNGMTSRLALPGSRKAALWDYFVRSYGETAGEIED
DFHTLFGEAFLHAYDMEVNQYKDSQSGSEEK
 
Nucleotide Sequence: 1776 bp     [Download]
>gi|479270911|ref|NC_021046.1|:762479-764254 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGCGATTCACGATTATTTCTACGAAACCCGGTCATCAGCCGCCGCAAAGCAGCTGTGATTTTTATGCCC
CGGGCGGCACCATTGGGCGCGGTACGGATAACAATCTGGTGCTGCCGGACAATGACCGCACCATCTCGCG
TTTGCAGGCCATCGTTCACGTCGACGCCAGTGGCGAATGCCGCGTCACGAACCGCGGCAGCGTTACCCGC
GTGGTACTGAATGATATCCCGCTGGAGCGTGGGCGTCAGGTTGAGCTTCAGGATGGGGATATTCTCGGTA
TTGATGATTATCGCATTGAAGTCAGCGAACTCATTCATGACACCCAGCCCGTAAGCCGCATGGCGGCCAG
CATGCAGCAGGCGCGCCCAGTGGCGACACCTGCACCAGCGCCGCAACCGAAACCGGCCAGCGCCGCGCCT
CGTGGAAAAGCTGAACCTACGGCCGTGCCGTCGGAAATCTGGGACAGCCTGATGCAGGAGTTTTCCATCT
CCGACAGCATCTCCAGCAACCGGGCAAAACCACAGCCCGCCGCATCCCACGATCCGTTCTCTCAGCCTGC
GGCCCCGGAGCGGAATGCCGAAGATCCGCTGGCAATGTTTAACGACGCCGAACCGTCGCTTGAACGTAAA
AACGTTGACCCGGACACGCTGTTTAGCGATGAAGCGTTGTTTAAAAAAGAGAGCATCTTTGACGATGTCA
CCCCTTCAACGCTGGTACAGCCGGACGAAAGCAAACCTGCCCAGCCAAAGGAAGAGGCGTCGGACGAACT
CGATCCGTTAGCCCTGTTTGGCGGGTCGGCGAGCGCACCTGCCGCGCGTCACGATGACCCTCTCGGCCTG
ATGGGCGGCGCGCCGTTAACCCATCCGGATGAAATCGTGGCCGATAAGCCGGAGCCAAAGCCTGAACCGC
AAGCCGCACAGGAAGAGGATGCGCTGGCCAGCTCACCGCTGTTCGATCCGGAACCGACTGAACCACAGGA
CGCGCCGCGCGCGGAAGAGGAGCCCGCGCGCCCCGATTACGCTGGCTTCACCATGCCAACACCGCAGGCC
GTGGCGCGCAGCAACGCGCAGGCGCCTAAAGGCCGACTGCGTATCGACCCGGTTAAAAACGCTGCATCGC
CTGCTGCCTCCGCGCAGACCGGCGAGCGGGGCGAGGTGCTTCAGGGCGAACTGCTGGAGGCGCTGCTGGA
GGGCATGGGCCTGAGCGAAATGCAGCCGGTACCGCAATTCGACCGGGAAAATATGCGTCAGCTGGGGCAG
ATCCTGGGCATGTTCTCGCAGGGGACCGTGGCGCTGCTCTCCTCGCGCTCCATCCTCAAGCGTGGGGTGA
AAGCCGATATGACCATGGTGCTCGACGATGCGAACAACCCGTTCAAACTGTTGCCGACCGGGAAAACGGT
GCTGATCCAGATGTTCGGCACGCCGATGCCGGGCTTTATGCCGCCGACCAAATCGGTGCGTGATGCGCTG
ATCGATCTCCAGGCACACCAGCTAGGGATGATCTCTGGTATCCGCGCCATTATCGCCGCCATGCTGCAAT
CCTTTAACCCGGAACAACTGGAAGAGCAGGCGAAGCAGAACGGGATGACGTCACGCCTGGCGCTGCCGGG
CAGCCGTAAAGCCGCGCTGTGGGATTATTTCGTTCGCAGCTATGGCGAGACGGCGGGCGAGATCGAGGAC
GACTTCCATACCCTGTTTGGCGAAGCCTTCCTCCATGCCTATGACATGGAGGTCAATCAGTACAAAGACT
CACAAAGCGGATCGGAAGAAAAATGA
 Primer design