SecReT6
Protein ID: 479271517
SecReT6 ID751
T6SS typei3
Gene symbol-
Locus tagENC_07340
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]767223..767786 [+]
Producttype VI secretion system lysozyme-related protein
NoteTssE
UniProt IDD6DQE9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.00E-19, Aligned region: 56..166
Protein Sequence: 187 a.a.     [Download]
>gi|479271517|ref|YP_007844796.1| type VI secretion system lysozyme-related protein [Enterobacter cloacae subsp. cloacae NCTC 9394]
MSNPAGEGDLLRSGWQARSRQEKVGARDKMQPSLLDRLTDNDPEKKRESANSNLITHAALRRNVLRDLQW
LFNTINHDASSDLSGLTQVSRSVVNFGVAPLAGKRMSDIEWHDIQRKLTEAIINFEPRILPQGLQVRCVS
DTSSLDLHNVLSIEIKGRLWCVPYPLEFLFRTDVDLENGHFELKDAG
 
Nucleotide Sequence: 564 bp     [Download]
>gi|479270911|ref|NC_021046.1|:767223-767786 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGAGTAATCCCGCAGGCGAAGGCGATCTGCTGCGCAGCGGCTGGCAGGCCCGCAGCAGGCAGGAGAAAG
TGGGGGCGCGCGACAAAATGCAGCCCTCACTGCTGGATCGCCTGACGGATAACGATCCGGAAAAAAAACG
CGAGTCCGCCAACAGCAATCTGATTACCCACGCCGCGCTGCGTCGTAACGTCCTGCGGGATTTACAGTGG
TTGTTTAACACCATTAACCACGATGCCTCCAGCGATCTGAGCGGGTTGACGCAGGTGAGCCGTTCCGTCG
TGAATTTTGGCGTGGCGCCGCTGGCGGGGAAAAGAATGTCCGATATCGAATGGCACGACATTCAGCGCAA
GCTCACCGAAGCGATTATTAACTTTGAACCGCGGATCCTGCCGCAGGGGCTTCAGGTTCGCTGCGTGTCC
GATACCTCCTCGTTAGATCTGCACAACGTTCTGTCTATCGAAATCAAAGGTCGCCTGTGGTGCGTGCCGT
ATCCGCTGGAATTTCTCTTTCGCACCGACGTCGATCTTGAGAACGGCCATTTTGAACTGAAGGATGCGGG
GTAA
 Primer design