SecReT6
Protein ID: 479271518
SecReT6 ID751
T6SS typei3
Gene symbol-
Locus tagENC_07350
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]767789..769660 [+]
Producttype VI secretion protein, VC_A0110 family
NoteTssF
UniProt IDD6DQF0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.90E-209, Aligned region: 5..623
Protein Sequence: 623 a.a.     [Download]
>gi|479271518|ref|YP_007844797.1| type VI secretion protein, VC_A0110 family [Enterobacter cloacae subsp. cloacae NCTC 9394]
MESKLLEYYNRELAYLREMGAEFAERYPKVAGRLGMRGIEVADPYIERLMEGFAFLTSRVQMKMDAEFPR
FSQRMLEMIAPNYLAPTPSMAIAEIQPDSSRGDLSKGFIVPRGTMMDSLALKKTGVTCSYTTAHEVNLLP
LKIERIELGGVPADLPLAQLGLSQRGISSALRVRIACDGPQHLGHLDFDRLEFFLSGPDIEALKLLELVM
EHHAGIVCQTVSKQPQRQLLSSDALRQEGFNADQALLPDDLRNFDGYRLLQEYFAFPARFRFISLSGLGK
LIQRCEDEKAFDIFILLDKSDDQLERVVDASHLALHCTPVINLFPKVAARQKLSESQHEYHLVVDNIRPL
DYEIYAVKKIYASADGQRDDQTFRPFWSTWSGDAGNYGAYFSLRREQRVLSEHALRYGTRTGYIGSEVFV
SLVDAQHAPWQENLRYISAEVLCTSRDLPLMLQQELGQFIMADSMPVKALTLRKGPTPPRPALAEGFSTW
RLISQLQMNYLSLMDSENEEGAAALRQLLGLYANLAETPVARQVDGVRHCVLEPVHRRVPEPGPVVFARG
IGITLTVDERAFSGASPWLFGSVLERLFARLVSINSFTEFTLKSQQRGEIGYWAPRMGKRALV
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|479270911|ref|NC_021046.1|:767789-769660 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGGAAAGCAAACTGCTCGAATATTACAACCGTGAACTGGCCTATCTGCGCGAGATGGGCGCAGAGTTCG
CCGAGCGCTACCCGAAAGTGGCGGGGCGGCTCGGCATGCGCGGCATCGAAGTGGCGGACCCGTACATTGA
GCGCCTGATGGAAGGTTTCGCCTTCCTGACCTCCCGCGTGCAGATGAAAATGGACGCCGAATTCCCGCGC
TTTTCACAGCGTATGCTGGAGATGATTGCGCCAAATTATCTGGCGCCTACGCCGTCGATGGCGATCGCTG
AAATTCAGCCCGACAGCAGCCGGGGCGACCTGAGCAAAGGCTTTATTGTGCCGCGCGGCACCATGATGGA
CAGCCTGGCGCTGAAAAAGACCGGGGTTACGTGCAGCTATACCACGGCGCACGAGGTCAACCTGCTGCCG
TTAAAAATTGAGCGGATCGAGCTGGGCGGCGTTCCCGCCGATCTGCCGCTGGCCCAGCTCGGCCTGAGCC
AGCGGGGGATCAGCAGCGCCTTGCGGGTCCGCATTGCCTGCGATGGCCCGCAGCATCTCGGGCACCTGGA
CTTTGACCGCCTGGAGTTCTTCTTAAGCGGCCCGGACATCGAGGCGCTGAAGCTGCTGGAGCTGGTGATG
GAGCACCACGCGGGTATTGTCTGCCAGACGGTCAGCAAGCAGCCCCAGCGCCAGCTGCTGTCGTCTGACG
CCCTGCGTCAGGAAGGCTTTAATGCGGACCAGGCGCTGCTCCCGGACGATCTGCGCAACTTCGACGGCTA
TCGCCTGTTGCAGGAGTACTTTGCGTTCCCGGCGCGTTTTCGTTTCATCAGCCTGAGCGGGCTGGGCAAG
CTGATCCAGCGCTGCGAAGACGAAAAAGCGTTTGATATCTTCATTCTGCTCGACAAGAGCGACGATCAGC
TGGAGCGCGTGGTGGATGCCAGCCACCTGGCGCTGCACTGCACGCCGGTGATCAACCTGTTCCCGAAAGT
GGCGGCCCGGCAGAAGCTGAGCGAAAGCCAGCATGAATACCACCTGGTGGTGGATAACATCCGCCCGCTG
GATTATGAAATTTATGCCGTGAAAAAAATCTATGCCAGCGCGGATGGTCAGCGGGACGACCAGACGTTTC
GTCCGTTCTGGAGTACCTGGAGCGGAGACGCGGGCAACTACGGCGCCTATTTTTCCCTGCGCCGTGAGCA
GCGCGTTCTCTCCGAACACGCGCTGCGCTATGGCACCCGCACGGGCTATATCGGCTCGGAGGTCTTCGTC
TCGCTGGTGGATGCGCAGCACGCGCCGTGGCAGGAGAATTTGCGCTACATTTCCGCCGAGGTGCTGTGCA
CCAGCCGCGACCTGCCGCTGATGCTCCAGCAGGAGCTTGGGCAGTTTATTATGGCCGACTCCATGCCGGT
GAAGGCGTTAACCCTGCGTAAAGGCCCGACGCCGCCGCGTCCGGCGCTGGCCGAAGGGTTCAGCACCTGG
CGGCTCATTAGCCAGCTGCAAATGAACTACCTTAGCCTGATGGACAGCGAAAACGAAGAGGGCGCAGCCG
CGCTGCGTCAGCTGTTAGGGCTATACGCCAACCTCGCCGAGACGCCGGTTGCCCGTCAGGTGGATGGCGT
TCGTCACTGCGTGCTGGAGCCGGTGCACCGCCGCGTGCCTGAACCCGGCCCGGTGGTGTTCGCCCGCGGG
ATCGGCATCACCCTGACGGTGGACGAACGCGCCTTTTCCGGCGCCAGCCCGTGGCTTTTCGGCAGCGTGC
TGGAACGCCTTTTTGCCCGCCTGGTCTCCATCAACAGCTTTACGGAGTTCACGCTCAAGAGCCAGCAGCG
CGGCGAAATCGGCTACTGGGCGCCGCGCATGGGTAAAAGGGCGCTGGTATGA
 Primer design