SecReT6
Protein ID: 479271519
SecReT6 ID751
T6SS typei3
Gene symbol-
Locus tagENC_07360
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]769657..770700 [+]
Producttype VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDD6DQF1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-107, Aligned region: 27..330
Protein Sequence: 347 a.a.     [Download]
>gi|479271519|ref|YP_007844798.1| type VI secretion protein, VC_A0111 family [Enterobacter cloacae subsp. cloacae NCTC 9394]
MSEVAPVTLRVHRLTPLPDAFWRGVRETPWRYDLFQLLRRIDAQGSERYPLGRAPLPKFEPLRIGQQPSM
GFAPSTVAEVRQREENGLHDVSILSFGLFGPNGPLPVHMTEYARERIHHHQDHSLSAFADLFHHRLTLLF
YRAWADAQPAVSLDRNDNRRFEGYLASLIGMGQPAQMSKGSLSAHARFTHAGHLTRHGRDPEGLEKILRN
YFNVPVRLVANVPQWMPLSTREQAQLGEGRRMPRMGESAFLGIAVRDVQHKFRLEIGPLSADDYNRFLPG
EGWVTELRDWVRQYAGVEFEWETRVILRADAVQGATLGSAGRLGYNTWLGLQPQPVPRGDLVYRAER
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|479270911|ref|NC_021046.1|:769657-770700 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGAGTGAAGTTGCCCCTGTAACGCTGCGCGTGCATCGCCTGACGCCGCTCCCCGATGCGTTCTGGCGCG
GGGTGCGCGAGACGCCGTGGCGCTACGATCTGTTCCAGCTGTTAAGACGCATTGATGCCCAGGGCAGTGA
GCGTTACCCGCTGGGGCGCGCGCCGCTGCCTAAATTTGAGCCGCTGCGTATTGGTCAGCAGCCTTCAATG
GGCTTTGCGCCGTCAACGGTTGCTGAGGTCCGGCAGCGGGAAGAGAACGGACTGCATGACGTTTCCATAC
TGAGCTTCGGCCTGTTTGGTCCTAACGGCCCGCTGCCGGTGCACATGACTGAGTATGCCCGCGAGCGTAT
TCATCATCATCAGGATCACAGCCTCAGCGCGTTTGCCGACCTCTTTCACCACCGCCTGACGCTGCTGTTC
TACCGCGCCTGGGCGGACGCGCAGCCTGCCGTTTCACTGGATCGCAACGACAACAGGCGCTTCGAAGGGT
ATCTGGCATCGCTGATTGGCATGGGGCAGCCTGCCCAGATGTCGAAAGGCAGCCTGAGCGCGCACGCCCG
CTTTACTCACGCCGGGCACCTGACCCGACACGGGCGGGACCCGGAAGGGCTGGAGAAAATCCTGCGCAAC
TATTTCAACGTGCCGGTCAGGCTGGTGGCCAACGTCCCGCAGTGGATGCCGCTCTCAACGCGGGAGCAGG
CACAGCTGGGCGAGGGGCGGCGTATGCCGCGCATGGGAGAGTCCGCTTTTCTCGGCATTGCGGTACGCGA
CGTGCAGCATAAATTTCGGCTTGAGATTGGCCCGTTGAGCGCAGACGACTACAACCGTTTTCTGCCGGGC
GAAGGGTGGGTGACCGAGCTGCGCGACTGGGTGCGACAGTACGCCGGGGTGGAATTTGAATGGGAAACAC
GGGTGATCCTGCGCGCCGATGCGGTGCAGGGCGCCACGCTCGGTAGCGCCGGGCGATTAGGGTACAACAC
CTGGCTCGGCCTTCAGCCTCAGCCTGTTCCGCGTGGCGATCTGGTGTATCGCGCAGAGCGATAA
 Primer design