SecReT6
Protein ID: 479271520
SecReT6 ID751
T6SS typei3
Gene symbol-
Locus tagENC_07370
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]770727..773354 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDD6DQF2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.40E-40, Aligned region: 227..245
AAA_2 [PF07724], Evalue: 2.40E-40, Aligned region: 606..771
AAA [PF00004], Evalue: 1.10E-21, Aligned region: 147..165
AAA [PF00004], Evalue: 1.10E-21, Aligned region: 227..359
AAA [PF00004], Evalue: 1.10E-21, Aligned region: 612..696
AAA [PF00004], Evalue: 1.10E-21, Aligned region: 807..856
ClpB_D2-small [PF10431], Evalue: 3.00E-16, Aligned region: 779..851
AAA_5 [PF07728], Evalue: 2.20E-13, Aligned region: 227..305
AAA_5 [PF07728], Evalue: 2.20E-13, Aligned region: 611..729
AAA_16 [PF13191], Evalue: 8.40E-12, Aligned region: 37..88
AAA_16 [PF13191], Evalue: 8.40E-12, Aligned region: 204..248
AAA_16 [PF13191], Evalue: 8.40E-12, Aligned region: 272..305
AAA_16 [PF13191], Evalue: 8.40E-12, Aligned region: 482..495
AAA_16 [PF13191], Evalue: 8.40E-12, Aligned region: 608..656
AAA_16 [PF13191], Evalue: 8.40E-12, Aligned region: 776..793
AAA_22 [PF13401], Evalue: 6.70E-08, Aligned region: 227..313
AAA_22 [PF13401], Evalue: 6.70E-08, Aligned region: 374..393
AAA_22 [PF13401], Evalue: 6.70E-08, Aligned region: 610..642
AAA_22 [PF13401], Evalue: 6.70E-08, Aligned region: 672..694
Sigma54_activat [PF00158], Evalue: 2.30E-07, Aligned region: 209..244
Sigma54_activat [PF00158], Evalue: 2.30E-07, Aligned region: 611..727
AAA_14 [PF13173], Evalue: 1.40E-06, Aligned region: 61..82
AAA_14 [PF13173], Evalue: 1.40E-06, Aligned region: 227..308
AAA_14 [PF13173], Evalue: 1.40E-06, Aligned region: 333..393
AAA_14 [PF13173], Evalue: 1.40E-06, Aligned region: 610..721
AAA_18 [PF13238], Evalue: 1.10E-05, Aligned region: 227..247
AAA_18 [PF13238], Evalue: 1.10E-05, Aligned region: 613..640
AAA_18 [PF13238], Evalue: 1.10E-05, Aligned region: 800..860
AAA_17 [PF13207], Evalue: 1.90E-05, Aligned region: 227..291
AAA_17 [PF13207], Evalue: 1.90E-05, Aligned region: 611..647
AAA_19 [PF13245], Evalue: 2.00E-05, Aligned region: 226..249
AAA_19 [PF13245], Evalue: 2.00E-05, Aligned region: 609..633
AAA_25 [PF13481], Evalue: 2.20E-05, Aligned region: 226..251
AAA_25 [PF13481], Evalue: 2.20E-05, Aligned region: 483..508
AAA_25 [PF13481], Evalue: 2.20E-05, Aligned region: 608..636
IstB_IS21 [PF01695], Evalue: 2.50E-05, Aligned region: 213..246
IstB_IS21 [PF01695], Evalue: 2.50E-05, Aligned region: 611..639
Zeta_toxin [PF06414], Evalue: 4.40E-05, Aligned region: 226..247
Zeta_toxin [PF06414], Evalue: 4.40E-05, Aligned region: 604..661
Zeta_toxin [PF06414], Evalue: 4.40E-05, Aligned region: 786..820
NACHT [PF05729], Evalue: 0.00012, Aligned region: 227..254
NACHT [PF05729], Evalue: 0.00012, Aligned region: 284..327
NACHT [PF05729], Evalue: 0.00012, Aligned region: 612..643
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 205..241
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 280..310
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 610..650
Clp_N [PF02861], Evalue: 0.00017, Aligned region: 32..79
Clp_N [PF02861], Evalue: 0.00017, Aligned region: 120..127
Clp_N [PF02861], Evalue: 0.00017, Aligned region: 314..324
AAA_29 [PF13555], Evalue: 0.0009, Aligned region: 219..242
AAA_29 [PF13555], Evalue: 0.0009, Aligned region: 609..636
RNA_helicase [PF00910], Evalue: 0.0022, Aligned region: 228..248
RNA_helicase [PF00910], Evalue: 0.0022, Aligned region: 612..633
RNA_helicase [PF00910], Evalue: 0.0022, Aligned region: 709..730
SRP54 [PF00448], Evalue: 0.0046, Aligned region: 226..247
SRP54 [PF00448], Evalue: 0.0046, Aligned region: 610..647
FtsK_SpoIIIE [PF01580], Evalue: 0.005, Aligned region: 212..270
FtsK_SpoIIIE [PF01580], Evalue: 0.005, Aligned region: 434..513
FtsK_SpoIIIE [PF01580], Evalue: 0.005, Aligned region: 610..633
Protein Sequence: 875 a.a.     [Download]
>gi|479271520|ref|YP_007844799.1| type VI secretion ATPase, ClpV1 family [Enterobacter cloacae subsp. cloacae NCTC 9394]
METNMSEISRAVLFGKLDTLLFTSLESATAFCKLRGNPYVELVHWLHQLMQQQDGDLQQVIRHFALDEQQ
LTRDIVAALDALPRGASSVSDLSEHIDSAVERAWVYGSLKFGVSRIRGGHLLIGILKTWNLANVLKSISA
QFTRLNVEVLIEQFDAICASSKESQQAAAAADAPAGAVPAAQGTLAQYGQDLTARAREGKIDPVVGRDEE
IRQMVDILMRRRQNNPLLTGEAGVGKTAVVEGLALRIADGDVPEPLQNVQLWLLDIGMLQAGAGMKGEFE
ARLQALINEVQSSATPIILFIDEIHTLIGAGGQQGTGDAANLLKPALARGQLRTIGATTWAEYKKYIEKD
PALTRRFQTVQVHEPDEAKAVLMLRSTVSPLETHHQVLLLDEAVSAAVKLSHRYIPARQLPDKAVALLDT
ACARVAVSQSAPPAQLEDCLRHLAALDVELEIAEREARVGAGDPARVAALTAERDAFETQREALARRWEE
ERTRVQEIILLRAALFAAGDEDTAELRGQLAEQQQALKTLQGDEPLLFAAVDENVVAAVVSDWTGIPLGR
MVKNEIDAVLNLADTLNQRVIGQRHGLDLIARRVKTSRAKLDDPNKPVGVFMLCGPSGVGKTETALALAE
SLYGGEQNVITINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHEIF
FQVFDKGWMEDGEGRHIDFRNTIIILTSNVGTDLIAAMCADPELMPEPDALSGALRQPLLEVFPPALLGR
LLVVPYYPLSDEMLGQIVRLQLRRIQRRLEENHNIISEFDDSVVEQIVQRCTEVESGGRMVDAILTNTLL
PQMSQILLTASRSDEQYRRLHVTCEQGEFHCQFAA
 
Nucleotide Sequence: 2628 bp     [Download]
>gi|479270911|ref|NC_021046.1|:770727-773354 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGGAAACTAACATGTCAGAAATTAGCCGTGCCGTGCTTTTCGGCAAACTGGATACGCTGTTATTTACCT
CTCTGGAAAGCGCGACTGCCTTCTGTAAGCTGCGCGGCAACCCGTACGTTGAGCTGGTGCACTGGCTGCA
TCAGCTGATGCAGCAGCAGGATGGCGATCTGCAACAGGTCATTCGTCACTTCGCCCTTGATGAACAGCAG
CTGACGCGCGATATCGTGGCGGCGCTGGATGCCCTGCCGCGTGGCGCGAGTTCCGTGTCTGATCTTTCCG
AGCATATCGACAGCGCCGTCGAGCGCGCCTGGGTCTACGGCTCGTTGAAGTTTGGCGTCAGCCGCATCCG
CGGCGGCCATTTGCTGATCGGCATACTGAAAACGTGGAATCTGGCTAACGTGCTGAAAAGCATTTCGGCG
CAGTTCACCCGTCTTAACGTCGAGGTGCTGATCGAGCAGTTCGACGCCATTTGCGCCAGCAGCAAAGAGA
GCCAGCAGGCCGCCGCCGCTGCGGACGCGCCTGCCGGGGCAGTACCGGCTGCGCAGGGCACGCTGGCGCA
GTATGGTCAGGATCTGACGGCGCGCGCCCGGGAAGGGAAAATCGACCCGGTGGTGGGGCGCGATGAAGAG
ATCCGCCAGATGGTCGATATTCTGATGCGTCGTCGCCAGAACAACCCCCTGCTGACCGGGGAAGCCGGCG
TCGGGAAAACGGCGGTGGTGGAAGGGCTGGCGCTGCGTATCGCTGACGGCGACGTGCCGGAGCCGCTGCA
AAACGTTCAGCTGTGGCTGCTGGATATCGGCATGCTTCAGGCCGGCGCGGGCATGAAAGGGGAATTTGAG
GCGCGCCTCCAGGCGCTGATTAACGAGGTGCAGTCCAGCGCCACGCCAATTATTCTGTTTATCGATGAGA
TCCACACTCTGATTGGCGCAGGCGGTCAACAGGGCACCGGCGATGCTGCTAACCTGCTCAAGCCTGCCCT
GGCGCGCGGGCAACTGCGCACCATCGGCGCGACCACCTGGGCGGAATACAAAAAATACATTGAGAAAGAT
CCGGCGCTGACCCGCCGTTTCCAGACCGTACAGGTTCACGAGCCGGACGAAGCCAAAGCCGTGCTGATGC
TGCGCAGCACCGTGTCGCCGCTGGAAACTCATCATCAGGTTTTACTCCTCGACGAAGCGGTCAGCGCGGC
GGTGAAACTGTCGCATCGCTATATTCCTGCGCGTCAGCTGCCGGATAAAGCGGTGGCGCTGCTGGACACC
GCCTGCGCGCGCGTGGCCGTCAGCCAGAGCGCGCCGCCTGCCCAGTTGGAAGACTGTCTGCGTCACCTGG
CGGCCCTGGACGTGGAGCTGGAGATTGCTGAACGCGAAGCGCGCGTGGGGGCGGGCGATCCGGCGCGTGT
GGCGGCCTTAACCGCCGAACGTGACGCGTTCGAAACCCAGCGCGAAGCCCTGGCCCGTCGCTGGGAAGAA
GAGCGCACGCGGGTGCAGGAGATTATCCTTCTGCGTGCCGCGCTGTTTGCGGCGGGTGATGAGGATACGG
CTGAACTGCGCGGCCAGCTGGCAGAACAGCAGCAGGCGCTGAAGACCTTACAGGGTGACGAACCGCTGCT
GTTTGCCGCGGTGGATGAGAACGTGGTGGCTGCGGTGGTCTCAGACTGGACCGGGATCCCGCTGGGCCGG
ATGGTGAAAAATGAGATCGACGCGGTGCTGAATCTGGCCGACACGCTGAACCAGCGGGTTATTGGTCAGC
GTCACGGTCTGGATCTGATTGCCCGTCGGGTAAAAACCTCGCGGGCGAAGCTTGACGATCCGAACAAACC
GGTCGGCGTATTCATGCTCTGCGGGCCATCCGGCGTGGGTAAAACCGAAACCGCGCTGGCGCTGGCGGAG
TCGCTTTACGGCGGCGAGCAGAACGTTATTACCATCAACATGAGTGAATTCCAGGAAGCGCACACCGTTT
CGACGTTAAAAGGTGCGCCTCCGGGCTATGTGGGCTATGGTGAAGGCGGCGTCTTAACCGAGGCCGTGCG
CCGCCGTCCCTACAGCGTGGTGCTGCTGGATGAAATTGAAAAAGCGCACCCGGACGTGCACGAGATCTTC
TTCCAGGTCTTCGACAAGGGCTGGATGGAGGACGGCGAAGGGCGTCACATTGATTTCCGTAACACCATTA
TTATTCTGACCTCTAACGTCGGCACCGACCTGATCGCAGCCATGTGCGCCGACCCGGAACTGATGCCGGA
GCCTGACGCGTTAAGCGGCGCCCTGCGCCAGCCGCTGCTGGAGGTGTTCCCGCCTGCGCTGCTGGGCCGC
CTGCTGGTGGTGCCGTATTACCCGCTGAGCGACGAGATGCTGGGGCAGATTGTGCGTCTTCAGCTCAGGC
GCATTCAGCGTCGTCTGGAAGAGAATCACAACATTATTTCTGAATTTGACGACAGCGTGGTCGAACAGAT
TGTTCAGCGCTGTACCGAGGTTGAGTCGGGCGGGCGTATGGTGGATGCGATTCTGACCAATACGTTGCTG
CCTCAGATGAGCCAGATTTTACTTACCGCCAGCCGCAGCGACGAGCAGTACCGACGTCTGCATGTCACCT
GCGAGCAGGGCGAATTCCACTGTCAGTTTGCCGCGTAA
 Primer design