SecReT6
Protein ID: 479271523
SecReT6 ID751
T6SS typei3
Gene symbol-
Locus tagENC_07420
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]777512..779434 [+]
Producttype VI secretion system Vgr family protein
NoteTssI
UniProt IDD6DQF5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.20E-77, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 1.40E-25, Aligned region: 364..457
Gp5_C [PF06715], Evalue: 0.0054, Aligned region: 500..519
Gp5_C [PF06715], Evalue: 0.0054, Aligned region: 517..533
Protein Sequence: 640 a.a.     [Download]
>gi|479271523|ref|YP_007844802.1| type VI secretion system Vgr family protein [Enterobacter cloacae subsp. cloacae NCTC 9394]
MLNRITVQLPVEGLLFWKLSGREAMSESFALTLTLLGTDARIDRSKLLGQPVTVTIPTQNLLTPRYINGK
VTRVAVSAVELTGIRYAVYQLTVEPDLWPMKRDRNLRIFQGQTVPQIVKTLLGEHQVNLEDKLTGSYRVW
DYCVQYQESSLDFISRLMELEGIAYYFSHEADKHTLVLTDAATQHQPFSGYEVIPYHQTPSGGSTDEEGI
SQWALEDSVTPGIYSLDDYDFRKPNAWLFQAQQNPASPKPGSIDVYDWPGRFVETGHAEFYARIRQERWQ
VEHQQIQATATAAGIAPGHIFTLTNAPFFSDNGEYLVTAAGYHFEENRYASGEGETIHRTDFTVIPASVS
YRPAQSTAWPRTYGPQTAKVVGPQGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGYGGV
QIPRVGDEVVVDFINGDPDRPIITGRVYNEASMPPWALPAAATQMGFMSRTKDGSVDNANALRFEDKAGA
EQVWIQAERNMDTSVKNDETHSVGGARSHYVKKNELHRVEANQIQAVKGGTEILTGKGKLDAAVEQYVIA
SGTKLRLVSGESAIELNANGKINLIGKEFNFFVEGDGYITTGGKLHLNTSGTQPGTTAPGSGHKGDIDAA
VQEKFTPPEE
 
Nucleotide Sequence: 1923 bp     [Download]
>gi|479270911|ref|NC_021046.1|:777512-779434 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGCTCAACCGAATTACCGTCCAGCTCCCGGTTGAGGGGCTGCTTTTCTGGAAACTCTCCGGCCGTGAGG
CGATGTCCGAGTCGTTCGCGCTGACGCTGACCCTGCTCGGCACAGACGCGCGCATTGACCGCAGCAAGCT
GCTGGGCCAGCCGGTCACGGTGACCATCCCCACGCAGAACCTGCTCACCCCCCGCTATATCAACGGCAAG
GTGACGCGCGTGGCGGTGAGCGCCGTGGAGCTGACGGGCATCCGCTACGCGGTGTACCAGCTGACGGTGG
AGCCGGACCTGTGGCCGATGAAGCGCGACCGTAACCTGCGTATCTTCCAGGGCCAGACGGTACCGCAGAT
TGTCAAAACCCTGCTGGGTGAGCATCAGGTTAACCTCGAAGACAAACTTACCGGCAGCTACCGGGTGTGG
GACTACTGCGTGCAGTATCAGGAATCGAGCCTGGACTTCATCAGCCGCCTGATGGAGCTGGAGGGGATTG
CGTACTACTTCAGCCACGAGGCGGACAAGCATACCCTGGTACTGACCGACGCCGCGACACAGCACCAGCC
GTTCAGCGGCTATGAGGTCATTCCTTACCATCAGACGCCGTCCGGCGGCAGTACGGATGAAGAGGGCATC
AGCCAGTGGGCGCTGGAGGACAGCGTCACGCCGGGAATTTACAGCCTCGACGACTATGACTTCCGCAAGC
CGAACGCGTGGCTGTTCCAGGCGCAGCAGAACCCGGCGTCCCCGAAGCCGGGCAGCATCGACGTGTACGA
CTGGCCGGGCCGCTTTGTGGAGACAGGGCATGCGGAGTTCTACGCCCGAATCCGTCAGGAGCGCTGGCAG
GTGGAGCATCAGCAGATTCAGGCGACGGCCACGGCGGCGGGCATTGCGCCGGGCCACATCTTTACCCTGA
CCAACGCGCCGTTCTTCAGTGACAACGGGGAGTATCTGGTGACGGCGGCGGGTTACCACTTCGAGGAGAA
CCGCTACGCGAGCGGTGAGGGGGAAACCATTCACCGCACCGATTTCACCGTTATCCCGGCGTCGGTGTCC
TACCGTCCGGCGCAGAGCACGGCGTGGCCGCGCACCTACGGCCCGCAGACGGCGAAAGTCGTGGGACCGC
AGGGGGAGAGTATCTGGACGGACAAATATGGCCGCGTGAAGGTGAAGTTCCACTGGGACCGCCTGGCGAA
GGGCGATGACACCAGCTCCTGCTGGGTGCGCGTGTCGAGCGCCTGGGCGGGCCAGGGCTACGGCGGGGTG
CAGATCCCGCGCGTCGGCGATGAGGTGGTGGTGGACTTTATCAACGGCGACCCGGACCGTCCGATTATCA
CTGGTCGCGTGTATAACGAAGCCAGCATGCCGCCGTGGGCGCTGCCGGCTGCCGCGACGCAGATGGGCTT
TATGAGCCGCACCAAGGACGGTTCCGTGGACAACGCCAACGCCCTGCGCTTTGAGGACAAGGCGGGTGCA
GAGCAGGTGTGGATCCAGGCCGAGCGTAACATGGACACCAGCGTTAAAAATGATGAAACGCACAGCGTCG
GCGGCGCGCGCAGCCATTACGTGAAGAAAAATGAGCTGCATCGCGTGGAGGCTAATCAGATCCAGGCCGT
GAAAGGCGGAACCGAGATCCTGACGGGTAAAGGCAAGCTGGATGCGGCGGTAGAGCAGTATGTTATTGCT
TCCGGGACGAAGCTGCGGCTGGTCTCGGGCGAGAGTGCTATTGAGCTTAACGCTAACGGCAAAATTAACC
TGATCGGCAAAGAGTTCAACTTCTTCGTTGAAGGGGACGGCTATATCACCACGGGCGGCAAGCTGCACCT
GAATACGTCGGGCACCCAACCGGGCACAACGGCGCCGGGGTCAGGGCATAAAGGGGATATTGATGCGGCG
GTGCAGGAGAAATTTACGCCCCCGGAAGAGTAA
 Primer design