SecReT6
Protein ID: 482895839
SecReT6 ID754
T6SS typei4a
Gene symbol-
Locus tagAvCA_50760
StrainAzotobacter vinelandii CA
Repliconchromosome [GenBank: NC_021149] [Browse all T6SS(s) in this replicon]
Location [Strand]5143660..5147478 [-]
Producthypothetical protein
NoteTssM
UniProt IDM9YBC8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.10E-31, Aligned region: 116..355
Protein Sequence: 1272 a.a.     [Download]
>gi|482895839|ref|YP_007895947.1| hypothetical protein AvCA_50760 [Azotobacter vinelandii CA]
MSLPEIDVAVIVALLLLLAAALLLAWLRSQAGSAVRGFYAAVRQMEHDRAVNDRYQTPWLLMIGDEERCA
QLCLDWQLKAAGKPAWFGCWWSDPDGALLVVPDALCMPEEGRPGRSAAWWRVLGLLLRLRSSRPLDALVW
VVPVAVLLDGEQAVARGIAARRAFIELLQRLGLSLPVYVLVTGMEEVPGFQELIAALPEEARETPLGWSS
PFAPEAAWQSHWSDLALDRLGRALSEAIVELGALSGRLGEALYCLPQRFEDMRGGLHALLDPVFQGNALG
EAPRLRGLYFVAGRAAAGGEPGQDLSGLDVPPLRGLFSRQLWQRRILAEQGLARAVPRILRLRQRWQQVA
GAAALVFGLFWSGAMLWVWYESSREAEDLARLLQETRNRYVALDDDARHRELSRQNAQAFWTLLERAPRW
RFASPAFPTSWLSPLDRRLEASLAGAARERLFQPLRDQLAADLDALGAMHGAGRHSSPEGDSPEQWQNYV
LAKGLVERVTRLEQQNRWLAQALGRPLAPLETLAAMGRDALGLQPGAGPLRHEAFYNRLLRTAPAPAMQA
LDLHANRKIAERFQNLMRQWLTQYFLAEHFVRPAGYLKIHLQKLQAGYGNSLRELEEVGGLIDNLRDLVA
LINAAWARGNGRDRVPGYEAMLDGARQTTLLGPAVVQAVEQEASRLQKSFRDQWIAQAGSRDNLLVLLGG
GSLELQEQVAGLDKSIESLLRHDFAAIALRREGEGEGEDESRAQPLAIDARALDTALGYYAGYKGYADQE
LAQIPPPYRAALLGAAARAASLAMWSSLESKGGVPRLGSERSFDVPADKALQLQEAFAELNSGDLAQALL
ENLNRRALGDVQEALAEVEALPMFHQGYDFALWDGGKGPGLQMFRAQDLQDLKQGLAQQFAVMLEATQAS
ARALEWLRMQRSHLSLADYDKVLRLTALGEEMLKHKAQNPASAPALFQQLVARDFVEMDGGTCPGILQAA
YLAQGQDDLSRRGQFLWEEARQRCDLLQQQRAATAWSRLADYFNQYLAERFPFSHDIRAVDVDPERVRHL
LRLIDEHLPQAEAGLQLARRSDRQAAQDFLLRLKQASGWLGALLLRDKNGLQGLDAEVRWRTDRADERGA
DQVIAWLLQAGRQEIAYPGDDPQRLRWTQGEPVRLVLRWAKNGSQRPVNDPLQPSLAVADREAGWEYTGP
WALLRLMRTHIAVQRQSYVDYTDFPLTFQLPVYGAYSSDSRAILFMRVSLMTQGGKAPLSIQPLPVRAPR
SPFAAPSVPQRW
 
Nucleotide Sequence: 3819 bp     [Download]
>gi|482892482|ref|NC_021149.1|:c5147478-5143660 Azotobacter vinelandii CA, complete genome
ATGAGCCTGCCGGAAATCGACGTGGCCGTGATTGTCGCGCTCCTGCTGTTGCTGGCGGCCGCGCTGTTGC
TCGCCTGGCTGCGCAGCCAGGCGGGCTCGGCGGTGCGCGGCTTCTATGCCGCGGTTCGCCAGATGGAGCA
CGACCGGGCGGTGAACGATCGCTACCAGACGCCCTGGCTGCTGATGATCGGCGACGAGGAACGCTGCGCG
CAGCTATGCCTGGACTGGCAGTTGAAGGCGGCCGGCAAGCCCGCCTGGTTCGGTTGCTGGTGGAGCGACC
CGGATGGCGCGCTGTTGGTCGTGCCGGATGCCCTGTGCATGCCGGAGGAAGGCCGGCCGGGCCGCTCCGC
CGCCTGGTGGCGGGTGCTCGGCCTGCTGCTGCGCCTGCGCTCCAGCCGCCCCCTGGATGCGCTGGTCTGG
GTCGTGCCGGTCGCCGTCCTGCTGGATGGCGAGCAGGCCGTGGCCCGCGGAATCGCCGCGCGCCGTGCTT
TCATCGAGCTGCTGCAGCGCCTGGGACTCAGCCTGCCGGTCTATGTGCTGGTGACCGGCATGGAGGAAGT
GCCCGGCTTCCAGGAACTGATCGCGGCGCTGCCCGAGGAGGCGCGCGAGACACCGCTCGGCTGGTCCTCG
CCTTTCGCGCCGGAGGCCGCCTGGCAGTCGCACTGGAGCGATCTGGCTCTCGATCGGCTGGGGCGCGCGC
TGTCCGAGGCGATCGTCGAGCTCGGCGCGCTGTCGGGACGGCTCGGCGAGGCCCTGTATTGCCTGCCGCA
GCGCTTCGAGGACATGCGCGGCGGCCTGCACGCGCTGCTCGACCCGGTGTTCCAGGGCAACGCCCTGGGC
GAGGCGCCGCGCTTGCGCGGCCTGTACTTCGTCGCCGGCCGGGCGGCAGCGGGCGGCGAACCGGGCCAGG
ACCTGTCGGGCCTCGACGTGCCGCCGCTGCGTGGCCTGTTCTCCCGTCAGCTCTGGCAGCGCCGCATCCT
CGCCGAGCAGGGGCTGGCCCGGGCGGTGCCGCGCATCCTCCGCCTGCGCCAGCGCTGGCAGCAGGTCGCC
GGTGCCGCCGCCCTGGTGTTCGGCCTGTTCTGGAGCGGAGCGATGCTGTGGGTCTGGTACGAGTCAAGCC
GCGAGGCCGAGGATCTGGCCAGGCTGCTGCAGGAAACCCGCAACCGCTACGTGGCGCTCGACGACGACGC
CCGCCACCGGGAGCTGAGCCGGCAGAACGCCCAGGCCTTCTGGACCCTGCTGGAACGCGCGCCGCGCTGG
CGTTTCGCGTCTCCGGCCTTTCCGACCTCCTGGCTCTCGCCGCTGGACCGTCGGCTGGAGGCAAGCCTGG
CGGGCGCTGCGCGGGAGCGGCTGTTCCAGCCGCTGCGCGACCAGTTGGCGGCCGATCTGGATGCACTGGG
TGCGATGCACGGTGCCGGGCGGCATTCCAGCCCCGAGGGCGACAGCCCCGAGCAGTGGCAGAACTATGTC
CTGGCCAAGGGCCTGGTCGAGCGGGTCACGCGCCTCGAACAGCAGAACCGCTGGCTCGCCCAGGCCCTGG
GCAGGCCCCTGGCGCCCCTGGAAACCCTCGCCGCCATGGGCCGCGATGCGCTTGGCCTGCAGCCGGGCGC
CGGGCCGCTGCGCCACGAGGCCTTCTACAACAGGCTCCTGCGCACGGCGCCCGCGCCGGCGATGCAGGCG
CTGGACCTGCACGCGAACCGGAAGATCGCCGAACGTTTCCAGAACCTGATGCGGCAGTGGCTGACCCAGT
ATTTCCTGGCCGAACACTTCGTCCGGCCGGCCGGCTACCTGAAGATTCACCTCCAGAAGCTGCAGGCCGG
CTACGGCAACTCCCTGCGCGAACTCGAGGAGGTCGGCGGGCTGATCGACAACCTGCGGGATCTCGTCGCC
CTGATCAACGCGGCCTGGGCGCGCGGCAACGGGCGGGACCGGGTGCCGGGCTACGAGGCGATGCTCGATG
GCGCGCGCCAGACCACCCTGCTCGGGCCGGCGGTGGTACAGGCCGTCGAGCAGGAGGCCTCGCGCCTGCA
GAAGAGCTTCCGCGACCAGTGGATCGCCCAGGCGGGCTCGCGCGACAACCTGCTGGTGCTGCTGGGCGGC
GGCAGTCTGGAACTGCAGGAGCAGGTCGCCGGGCTGGATAAGTCCATCGAAAGCCTGCTACGGCACGATT
TCGCCGCCATCGCCTTGCGCCGCGAGGGCGAGGGCGAGGGCGAGGATGAGTCCCGCGCCCAGCCCCTGGC
CATCGATGCCCGCGCGCTCGACACCGCGCTGGGCTACTACGCCGGCTACAAGGGTTATGCCGACCAGGAG
CTGGCGCAGATACCGCCGCCGTACCGTGCGGCCCTGCTCGGAGCGGCCGCACGCGCGGCTTCGCTGGCCA
TGTGGAGCAGCCTGGAGTCGAAGGGGGGCGTGCCGCGCCTGGGCAGCGAGCGTTCCTTCGACGTGCCGGC
GGACAAGGCCCTGCAACTGCAGGAGGCTTTCGCCGAGCTGAACAGTGGCGATCTGGCCCAGGCTTTGCTG
GAAAACCTCAACCGCCGGGCCCTGGGCGACGTGCAAGAAGCGCTGGCGGAGGTCGAGGCGCTGCCCATGT
TCCACCAGGGCTACGACTTCGCTCTGTGGGATGGCGGCAAGGGACCGGGCCTGCAGATGTTCCGCGCCCA
GGATCTGCAGGACCTCAAGCAGGGGCTGGCCCAGCAGTTCGCGGTCATGCTGGAAGCCACCCAGGCCAGC
GCCCGGGCGCTGGAATGGCTGCGGATGCAGCGCTCGCACCTGTCGCTGGCCGACTACGACAAGGTCCTGC
GGCTGACCGCGCTGGGCGAGGAGATGCTCAAGCACAAGGCGCAGAACCCGGCCAGCGCGCCGGCGCTGTT
CCAGCAACTGGTCGCCCGCGACTTCGTCGAGATGGACGGCGGAACCTGCCCGGGCATCCTCCAGGCCGCC
TATCTGGCGCAGGGACAGGATGACCTGTCGCGGCGCGGGCAGTTCCTCTGGGAGGAGGCGCGGCAGCGCT
GCGACCTCCTCCAGCAACAGCGCGCGGCCACCGCCTGGAGCCGCCTGGCCGACTATTTCAACCAGTATCT
GGCCGAGCGCTTCCCGTTCTCCCACGATATCCGTGCCGTCGATGTCGATCCCGAACGGGTTCGCCACCTG
CTGCGGCTGATCGACGAGCACCTGCCCCAGGCCGAGGCGGGCCTGCAACTCGCCCGCCGGTCCGACCGGC
AGGCCGCGCAGGACTTTCTGCTGCGTCTGAAGCAGGCCTCCGGTTGGCTGGGAGCGTTGCTGCTGCGCGA
CAAGAACGGTCTGCAGGGGCTCGACGCGGAGGTGCGCTGGCGCACCGACCGCGCGGACGAGCGCGGCGCC
GACCAGGTGATCGCCTGGCTGCTGCAGGCGGGCCGCCAGGAGATCGCCTATCCGGGCGACGATCCGCAGC
GCCTGCGCTGGACCCAGGGCGAACCGGTCCGCCTGGTGCTGCGCTGGGCGAAGAACGGCTCGCAGCGGCC
GGTGAACGATCCGCTGCAGCCGAGCCTGGCGGTCGCCGACCGCGAGGCCGGCTGGGAATACACCGGTCCC
TGGGCGCTGCTGCGCCTGATGCGTACCCACATCGCCGTGCAGCGGCAGTCGTACGTCGACTACACCGACT
TCCCGCTGACCTTCCAGTTGCCGGTCTACGGGGCTTACAGCAGCGACAGCCGGGCGATCCTGTTCATGCG
CGTGTCGCTGATGACCCAGGGCGGCAAGGCGCCGCTCTCCATCCAGCCGCTGCCGGTACGTGCCCCCCGT
TCCCCTTTCGCCGCGCCGTCCGTGCCGCAGCGCTGGTGA
 Primer design