SecReT6
Protein ID: 482900857
SecReT6 ID755
T6SS typei3
Gene symbol-
Locus tagAvCA6_26610
StrainAzotobacter vinelandii CA6
Repliconchromosome [GenBank: NC_021150] [Browse all T6SS(s) in this replicon]
Location [Strand]2724512..2727172 [-]
ProductClpA/B-type protease
NoteTssH
UniProt IDM9YJT0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.20E-41, Aligned region: 221..327
AAA_2 [PF07724], Evalue: 4.20E-41, Aligned region: 605..772
AAA [PF00004], Evalue: 4.20E-21, Aligned region: 221..354
AAA [PF00004], Evalue: 4.20E-21, Aligned region: 611..695
AAA_5 [PF07728], Evalue: 8.70E-14, Aligned region: 221..299
AAA_5 [PF07728], Evalue: 8.70E-14, Aligned region: 346..381
AAA_5 [PF07728], Evalue: 8.70E-14, Aligned region: 610..729
ClpB_D2-small [PF10431], Evalue: 6.10E-13, Aligned region: 778..847
AAA_16 [PF13191], Evalue: 8.30E-10, Aligned region: 36..81
AAA_16 [PF13191], Evalue: 8.30E-10, Aligned region: 198..241
AAA_16 [PF13191], Evalue: 8.30E-10, Aligned region: 265..300
AAA_16 [PF13191], Evalue: 8.30E-10, Aligned region: 458..458
AAA_16 [PF13191], Evalue: 8.30E-10, Aligned region: 586..655
AAA_22 [PF13401], Evalue: 3.20E-08, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 3.20E-08, Aligned region: 363..389
AAA_22 [PF13401], Evalue: 3.20E-08, Aligned region: 609..632
AAA_22 [PF13401], Evalue: 3.20E-08, Aligned region: 672..694
AAA_25 [PF13481], Evalue: 2.30E-07, Aligned region: 221..294
AAA_25 [PF13481], Evalue: 2.30E-07, Aligned region: 606..636
Sigma54_activat [PF00158], Evalue: 6.20E-07, Aligned region: 216..236
Sigma54_activat [PF00158], Evalue: 6.20E-07, Aligned region: 610..723
AAA_19 [PF13245], Evalue: 1.30E-06, Aligned region: 219..246
AAA_19 [PF13245], Evalue: 1.30E-06, Aligned region: 376..398
AAA_19 [PF13245], Evalue: 1.30E-06, Aligned region: 608..633
AAA_17 [PF13207], Evalue: 6.40E-06, Aligned region: 221..262
AAA_17 [PF13207], Evalue: 6.40E-06, Aligned region: 433..443
AAA_17 [PF13207], Evalue: 6.40E-06, Aligned region: 610..647
NACHT [PF05729], Evalue: 4.50E-05, Aligned region: 36..53
NACHT [PF05729], Evalue: 4.50E-05, Aligned region: 221..248
NACHT [PF05729], Evalue: 4.50E-05, Aligned region: 610..646
AAA_29 [PF13555], Evalue: 5.40E-05, Aligned region: 211..237
AAA_29 [PF13555], Evalue: 5.40E-05, Aligned region: 608..635
Zeta_toxin [PF06414], Evalue: 6.10E-05, Aligned region: 221..241
Zeta_toxin [PF06414], Evalue: 6.10E-05, Aligned region: 605..650
AAA_14 [PF13173], Evalue: 6.30E-05, Aligned region: 221..301
AAA_14 [PF13173], Evalue: 6.30E-05, Aligned region: 609..705
AAA_18 [PF13238], Evalue: 0.00012, Aligned region: 221..241
AAA_18 [PF13238], Evalue: 0.00012, Aligned region: 611..639
IstB_IS21 [PF01695], Evalue: 0.00018, Aligned region: 214..240
IstB_IS21 [PF01695], Evalue: 0.00018, Aligned region: 610..630
TIP49 [PF06068], Evalue: 0.0009, Aligned region: 221..243
TIP49 [PF06068], Evalue: 0.0009, Aligned region: 269..301
TIP49 [PF06068], Evalue: 0.0009, Aligned region: 609..646
DUF815 [PF05673], Evalue: 0.0016, Aligned region: 215..297
DUF815 [PF05673], Evalue: 0.0016, Aligned region: 344..378
DUF815 [PF05673], Evalue: 0.0016, Aligned region: 604..649
Clp_N [PF02861], Evalue: 0.0023, Aligned region: 26..75
Clp_N [PF02861], Evalue: 0.0023, Aligned region: 114..130
FtsK_SpoIIIE [PF01580], Evalue: 0.0048, Aligned region: 199..263
FtsK_SpoIIIE [PF01580], Evalue: 0.0048, Aligned region: 282..308
FtsK_SpoIIIE [PF01580], Evalue: 0.0048, Aligned region: 606..644
AAA_30 [PF13604], Evalue: 0.0059, Aligned region: 207..238
AAA_30 [PF13604], Evalue: 0.0059, Aligned region: 608..641
Hpr_kinase_C [PF07475], Evalue: 0.0073, Aligned region: 221..233
Hpr_kinase_C [PF07475], Evalue: 0.0073, Aligned region: 607..628
RuvB_N [PF05496], Evalue: 0.0087, Aligned region: 220..238
RuvB_N [PF05496], Evalue: 0.0087, Aligned region: 292..302
RuvB_N [PF05496], Evalue: 0.0087, Aligned region: 575..631
RuvB_N [PF05496], Evalue: 0.0087, Aligned region: 679..703
Protein Sequence: 886 a.a.     [Download]
>gi|482900857|ref|YP_007898671.1| ClpA/B-type protease [Azotobacter vinelandii CA6]
MSDISRVSLFGKLDPLLFSTLEKATAFCRQRGNPYVELAHWLFQQWQESEGDLRLAARHFELDGERLERD
LQAALDRLPRGAGAVSDLSGHIDDAVERAWVYGSLKFGAARIRGAHLLIGLLRTAALRHLLFGISREFER
ILPDVLGERLDSILAGSSEEVVVSAAAAGAPSPAADRALEQYGVNLSERARTGEIDPVTGRDGEIRQMVD
VLLRRRQNNPLLTGEAGVGKTAVVEGLALRIAAGEVPPPLREVELYLLDIGLLQAGASVKGEFERRLRQL
IDEVRASPRPIVLFIDEIHTLMGAGGNAGTGDAANLLKPMLARGELRTIGATTWAEYKRHIEKDPALTRR
FQVVQIHEPDEERALAMIRGLAGKLAHHHGVLLLDEALRAAVSLSHRYIPARQLPDKAVSLLDTACARVA
VSQHALPPELEDCRRRIETLRVERGIVEHECAIGAGDASRLDELATRLAGEEAECERLMARWRDEQELAA
RIFDLRARLGGGAATPAEEEVRRPLLAELYTVLAELEARQQDEPLILPAVDTHAVAAVVADWTGIPVGRM
LKDEAAAVLNLADTLAARVIGQRHGLEAIARRIRTARARLDDPGKPVGVFLLAGPSGVGKTETALALAEA
LYGGEQNLIVINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEVEKAHPDVHEIFF
QVFDKGWMEDGEGRRIDFKNTLIILTSNVGSDLLMRLCQDPQRIPDPEALAGALREPLRRVFPAALLGRL
SVVPYYPLSDEMLARIVRLQLERIGRRLRDNHGIDFHYAQAAVQLVGARCTEVESGGRMVDAILTHTVLP
HISRELLLRAGGEAPLTRIQLDAEQGEFVYRFESGQTPADAQRGRD
 
Nucleotide Sequence: 2661 bp     [Download]
>gi|482897536|ref|NC_021150.1|:c2727172-2724512 Azotobacter vinelandii CA6, complete genome
ATGTCTGATATCAGTCGCGTCTCGTTGTTCGGCAAGCTCGACCCCTTGCTGTTTTCCACGCTGGAGAAGG
CCACCGCGTTCTGCCGGCAGCGCGGCAACCCCTATGTGGAACTGGCCCACTGGCTGTTCCAGCAATGGCA
GGAAAGCGAAGGCGACCTGCGCCTCGCGGCGCGCCACTTCGAACTGGACGGCGAGCGCCTGGAGCGCGAC
CTGCAGGCCGCCCTCGACCGCCTGCCGCGCGGCGCCGGGGCGGTCAGCGACCTGTCCGGGCACATCGACG
ACGCGGTGGAGCGGGCCTGGGTGTACGGCAGCCTGAAGTTCGGCGCCGCCCGCATCCGCGGCGCCCACCT
GCTGATCGGCCTGCTGCGCACCGCCGCGCTGCGCCACCTGCTGTTCGGCATCTCCCGCGAATTCGAGCGC
ATCCTGCCCGATGTGCTGGGTGAGCGCCTGGACAGCATCCTGGCCGGTTCGAGCGAGGAGGTGGTGGTGT
CGGCGGCCGCCGCCGGCGCGCCGTCCCCGGCCGCCGACAGGGCGCTGGAGCAATACGGAGTCAACCTGAG
CGAACGCGCCAGGACGGGCGAGATCGACCCGGTGACCGGACGCGACGGCGAGATCCGCCAGATGGTCGAC
GTGCTGTTGCGCCGCCGCCAGAACAATCCGCTGCTGACCGGCGAGGCGGGCGTCGGCAAGACCGCGGTGG
TCGAGGGGCTGGCGCTGCGCATCGCCGCCGGCGAGGTGCCGCCGCCTTTGCGCGAGGTGGAGCTGTACCT
GCTCGACATCGGCCTGCTGCAGGCCGGCGCCAGCGTCAAGGGCGAGTTCGAGCGCCGTTTGCGGCAACTG
ATCGACGAGGTGCGCGCCAGCCCGCGTCCCATCGTGCTGTTCATCGACGAGATCCATACCCTGATGGGCG
CCGGCGGCAACGCCGGCACCGGCGACGCCGCCAACCTGCTCAAGCCGATGCTGGCCCGCGGCGAACTGCG
CACCATCGGCGCCACCACCTGGGCCGAGTACAAGAGGCACATCGAGAAGGACCCCGCGCTGACCCGCCGC
TTCCAGGTGGTGCAGATCCACGAGCCGGACGAGGAGCGCGCCCTGGCGATGATCCGCGGCCTGGCCGGCA
AGCTGGCGCACCATCACGGCGTGCTGCTGCTCGACGAGGCGCTGCGCGCCGCGGTGAGCCTGTCGCACCG
CTACATCCCGGCGCGGCAATTGCCGGACAAGGCGGTCAGCCTGCTGGACACCGCCTGCGCGCGGGTCGCG
GTGAGCCAGCACGCCCTGCCGCCGGAGCTGGAGGATTGCCGGCGGCGCATCGAGACGCTGCGCGTCGAGC
GCGGCATCGTCGAGCACGAATGCGCCATCGGCGCCGGCGACGCCTCGCGGCTCGACGAACTGGCGACGCG
GCTGGCCGGCGAGGAGGCCGAGTGCGAACGCCTGATGGCGCGCTGGCGCGACGAACAGGAACTGGCGGCG
CGGATCTTCGATCTGCGCGCCCGGCTGGGCGGCGGCGCCGCGACGCCGGCGGAAGAGGAGGTCCGCCGGC
CCCTGCTGGCCGAACTGTACACGGTGCTGGCCGAACTGGAGGCCCGCCAGCAGGACGAACCGCTGATCCT
GCCGGCGGTGGACACCCACGCGGTCGCCGCCGTGGTGGCGGACTGGACCGGCATCCCGGTCGGCCGCATG
CTCAAGGACGAGGCCGCCGCCGTGCTCAACCTGGCCGACACCCTGGCGGCGCGGGTGATCGGCCAGCGCC
ACGGCCTGGAGGCGATCGCCCGGCGGATCCGGACCGCCCGCGCGCGGCTCGACGATCCGGGCAAGCCGGT
CGGCGTGTTCCTGCTCGCCGGCCCTTCGGGGGTGGGCAAGACCGAGACCGCGCTGGCGCTGGCCGAGGCG
TTGTACGGCGGCGAGCAGAACCTGATCGTCATCAACATGAGCGAGTTCCAGGAGGCGCACACCGTCAGCA
CCCTGAAAGGGGCGCCGCCCGGCTACGTCGGCTACGGCGAGGGCGGCGTGCTGACCGAGGCGGTGCGCCG
GCGTCCCTACAGCGTGGTGCTGCTGGACGAGGTGGAGAAGGCCCACCCGGACGTGCACGAGATCTTCTTC
CAGGTGTTCGACAAGGGCTGGATGGAGGACGGCGAGGGCCGCCGCATCGACTTCAAGAACACCCTGATCA
TCCTCACCTCCAACGTCGGCAGCGACCTGCTGATGCGCCTCTGCCAGGACCCGCAGCGGATTCCCGACCC
CGAGGCGCTGGCCGGCGCGCTGCGCGAGCCGCTGCGCCGGGTGTTCCCGGCGGCGCTGCTCGGGCGCCTG
TCGGTGGTGCCCTATTACCCGCTGTCGGACGAGATGCTGGCGCGCATCGTCCGCCTGCAACTGGAGCGGA
TCGGCCGCCGCCTGCGCGACAACCACGGCATCGATTTCCACTACGCGCAGGCGGCGGTGCAACTGGTCGG
CGCGCGCTGCACCGAGGTCGAGTCGGGCGGGCGCATGGTCGACGCCATCCTCACCCATACGGTGCTGCCA
CACATCAGCCGCGAACTGCTGCTGCGCGCCGGCGGCGAGGCGCCGCTGACGCGCATCCAGCTGGACGCGG
AGCAGGGCGAATTCGTCTACCGCTTCGAGAGCGGGCAGACGCCGGCCGACGCGCAAAGAGGACGGGACTG
A
 Primer design