SecReT6
Protein ID: 482900858
SecReT6 ID755
T6SS typei3
Gene symbol-
Locus tagAvCA6_26620
StrainAzotobacter vinelandii CA6
Repliconchromosome [GenBank: NC_021150] [Browse all T6SS(s) in this replicon]
Location [Strand]2727165..2728178 [-]
Producthypothetical protein
NoteTssG
UniProt IDM9YIY2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.10E-110, Aligned region: 10..314
Protein Sequence: 337 a.a.     [Download]
>gi|482900858|ref|YP_007898672.1| hypothetical protein AvCA6_26620 [Azotobacter vinelandii CA6]
MDAPLWQALRAEPHAHDLFQVLRWLDARAGLPVPLGRAARPQDEPLRLGQRPSLSFAPSMIAGLDETLER
PPYLSIFGFGLFGPHGPLPLHLTEYAHDRERMAGDPTLAAFADLFHHRLILLFYRAWADAQPTVGLDRPG
ANRFEDYIACLLGRGLEAQRDAEPLGRHAIYHQAGHLLRQTRNPEGLQRILSGYFGIPVRIVEYVAHWVA
LEPDARLALGRSGENMGLGTGATLGCAVRDAQSRFRLVLGPMGWADYRRFLPGGDRVPALLHWLREYVGL
ELAWDAQLILAADQVRGTALGEPRPLGLGTWLGRRPADAGDAGDLIIDYSHLGESHV
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|482897536|ref|NC_021150.1|:c2728178-2727165 Azotobacter vinelandii CA6, complete genome
ATGGACGCTCCGCTGTGGCAGGCGCTGCGCGCCGAGCCGCATGCCCACGACCTGTTCCAGGTGCTGCGCT
GGCTGGATGCCCGCGCCGGCCTGCCGGTCCCGCTGGGACGCGCCGCGCGGCCGCAGGACGAGCCGCTGCG
CCTGGGCCAGCGGCCCTCGCTGTCGTTCGCGCCGTCGATGATCGCCGGTCTGGACGAAACGCTGGAGCGG
CCGCCGTACCTGTCGATCTTCGGCTTCGGCCTGTTCGGCCCCCACGGCCCGCTGCCGCTGCACCTGACCG
AATACGCCCACGACCGCGAGCGCATGGCGGGCGACCCGACCCTGGCCGCCTTCGCCGATCTTTTCCATCA
CCGGCTGATCCTGCTGTTCTACCGCGCCTGGGCCGACGCGCAGCCCACCGTCGGCCTCGACCGCCCCGGC
GCCAACCGCTTCGAGGACTACATCGCCTGCCTGCTGGGCCGGGGGCTGGAGGCGCAACGGGACGCCGAGC
CGCTGGGACGCCACGCCATTTACCACCAGGCCGGCCACCTGCTGCGGCAGACGCGCAACCCGGAAGGCCT
GCAACGGATTCTGAGCGGCTATTTCGGGATACCGGTGCGCATCGTCGAGTACGTGGCGCACTGGGTGGCG
CTGGAGCCGGACGCCCGCCTGGCCCTGGGCCGCAGCGGCGAGAACATGGGCCTGGGCACGGGCGCGACCC
TGGGCTGCGCGGTGCGCGACGCCCAGTCGCGTTTCCGCCTGGTCCTCGGGCCGATGGGCTGGGCGGACTA
CCGCCGTTTTCTGCCCGGCGGCGACCGGGTGCCGGCCCTGCTGCACTGGCTGCGCGAATACGTCGGGCTG
GAACTGGCCTGGGACGCGCAACTGATCCTGGCCGCCGACCAGGTGCGCGGCACCGCCCTCGGCGAGCCGC
GCCCGCTGGGCCTGGGCACCTGGCTCGGCCGGCGGCCGGCGGATGCCGGCGACGCCGGCGATCTGATCAT
CGATTACAGCCACCTGGGGGAGTCCCATGTCTGA
 Primer design