SecReT6
Protein ID: 482900859
SecReT6 ID755
T6SS typei3
Gene symbol-
Locus tagAvCA6_26630
StrainAzotobacter vinelandii CA6
Repliconchromosome [GenBank: NC_021150] [Browse all T6SS(s) in this replicon]
Location [Strand]2728202..2730064 [-]
Producthypothetical protein
NoteTssF
UniProt IDM9YFX0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-214, Aligned region: 5..619
Protein Sequence: 620 a.a.     [Download]
>gi|482900859|ref|YP_007898673.1| hypothetical protein AvCA6_26630 [Azotobacter vinelandii CA6]
MDARLLDYYNRELGYLRELGAEFAERFPKVAGRLGMHGIEIADPYVERLLEGFSFLTARIQLKMDAEFPR
LSQHLLDVIHPNYSAPMPAMAIVRLQPSLNEGSLANGFTLPAGTALHANLAHGEQTVCEFRTGHALTLWP
LELDGVHYGRVPTDLPAGAYRQRARAALRIRLRITAGQRCDSLALERLEFHLAGPEQRALRLLELIAGHS
VAVLCREAGPDGAWGTPLDAACVRHEGFSASQALLPDDGRTFQGYRLLQEYFACPARFLFFSVGGLRRAL
QGLRGERFELLLLFDQDDAALERLVETDDLALHCTPVVNLFAKRADRVLVSPRSRDYHLVVDRTRALDYE
VHSVTRMSGHGSGSEAQEFRPFYASFGADGRDHGAYYALRREPRLLSEQARLHGSRTGYVGSEIFVSLVD
QHEAPFGAALRHLVVETLCTNRDLPLLLPLDGDSDFSLAVSAPVGRVKVLRGPTRPRPSLAEGAQTWKLI
SHLGLNHRLMTELDGERGAAMLRQLLALYLDDAESGLRRQVESLRRVACSPVFRRLPQPGPLMHGRGVQV
AVTLDEQAFSGDSPFLFGAVLEQFFARHVAINLFSELTLHSLQRGQVARWAPRLGARPVA
 
Nucleotide Sequence: 1863 bp     [Download]
>gi|482897536|ref|NC_021150.1|:c2730064-2728202 Azotobacter vinelandii CA6, complete genome
ATGGATGCGCGTCTACTGGATTACTACAACCGGGAACTGGGCTACCTGCGCGAGCTGGGAGCGGAGTTCG
CCGAACGTTTTCCCAAGGTGGCCGGCCGCCTGGGCATGCACGGCATCGAAATCGCCGACCCCTATGTCGA
GCGCCTGCTCGAAGGTTTCAGCTTCCTCACCGCGCGCATCCAACTGAAGATGGACGCGGAGTTTCCGCGC
CTTTCCCAGCACCTGCTCGATGTGATCCATCCCAACTACTCGGCGCCGATGCCGGCGATGGCCATCGTCA
GGCTGCAACCCAGCCTCAACGAGGGCAGCCTGGCCAACGGCTTCACGCTGCCCGCCGGCACCGCGCTGCA
TGCCAACCTGGCCCACGGCGAGCAGACCGTCTGCGAGTTCCGCACCGGCCATGCGCTCACCCTGTGGCCG
CTGGAGCTGGACGGCGTGCACTACGGCCGGGTGCCCACCGACCTGCCCGCCGGGGCATACCGGCAGCGCG
CCCGCGCCGCCCTGCGCATCCGCCTGCGCATCACCGCCGGCCAGCGCTGCGACAGCCTGGCCCTGGAGCG
GCTGGAGTTCCACCTGGCGGGCCCCGAGCAGCGGGCGCTGCGCCTGCTGGAGCTGATCGCCGGTCACAGC
GTCGCGGTGCTCTGCCGCGAGGCCGGCCCGGACGGCGCCTGGGGCACGCCGCTGGACGCCGCCTGCGTGC
GTCACGAGGGCTTTTCCGCCAGCCAGGCGCTGTTGCCCGACGACGGCCGCACCTTCCAGGGCTACCGGCT
GCTGCAGGAATACTTCGCCTGCCCGGCGCGTTTCCTGTTCTTCAGCGTCGGCGGCCTGCGCCGCGCGCTG
CAGGGGCTGCGGGGCGAGCGCTTCGAACTGCTGCTGCTGTTCGATCAGGACGACGCCGCACTGGAGCGCC
TGGTGGAGACGGACGACCTGGCGCTGCACTGCACGCCGGTCGTCAACCTGTTCGCCAAGCGCGCCGACCG
GGTGCTGGTCTCGCCGCGCAGCCGCGACTACCACCTGGTGGTGGACCGCACCCGGGCGCTCGACTACGAG
GTGCATTCGGTCACCCGCATGTCCGGCCACGGCAGCGGCAGCGAGGCCCAGGAGTTCCGTCCGTTCTACG
CCTCGTTCGGCGCCGACGGACGCGACCACGGCGCCTACTACGCGCTGCGCCGCGAGCCGCGCCTGCTCTC
CGAGCAGGCCCGCCTGCACGGCAGCCGCACCGGCTATGTCGGCAGCGAAATCTTCGTTTCCCTGGTGGAT
CAGCACGAGGCGCCCTTCGGCGCGGCGCTCCGCCATCTGGTGGTGGAGACACTGTGCACCAACCGCGACC
TGCCGCTGCTGCTGCCGCTGGACGGCGACAGCGATTTCTCGCTGGCGGTATCGGCCCCGGTGGGACGGGT
CAAGGTGTTGCGCGGGCCGACCCGGCCCCGGCCGTCGCTGGCCGAGGGCGCGCAGACCTGGAAGCTGATC
AGCCACCTGGGCCTGAACCATCGGCTCATGACCGAACTGGACGGCGAGCGCGGCGCGGCCATGCTGCGCC
AGTTGCTGGCCTTGTACCTGGACGACGCCGAGTCGGGCCTGCGGCGCCAGGTGGAAAGCCTGCGGCGGGT
CGCCTGCAGCCCGGTGTTCCGCCGCCTGCCGCAACCCGGCCCCCTGATGCACGGGCGCGGCGTGCAGGTG
GCGGTGACGCTGGACGAACAGGCGTTCTCCGGCGACAGCCCCTTTCTGTTCGGCGCCGTGCTGGAGCAGT
TCTTCGCCCGCCACGTGGCGATCAACCTGTTCTCCGAACTGACGCTGCACAGCCTGCAGCGCGGCCAGGT
GGCGCGCTGGGCGCCCCGGCTGGGCGCGAGGCCGGTGGCATGA
 Primer design