SecReT6
Protein ID: 482900860
SecReT6 ID755
T6SS typei3
Gene symbol-
Locus tagAvCA6_26640
StrainAzotobacter vinelandii CA6
Repliconchromosome [GenBank: NC_021150] [Browse all T6SS(s) in this replicon]
Location [Strand]2730064..2730606 [-]
Producthypothetical protein
NoteTssE
UniProt IDM9YR15
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-21, Aligned region: 48..159
Protein Sequence: 180 a.a.     [Download]
>gi|482900860|ref|YP_007898674.1| hypothetical protein AvCA6_26640 [Azotobacter vinelandii CA6]
MADPLHTPRDRRQARGKRDRLRPALLDRLTDDEPLQRTEPLTPGASTGELRAAVLRDLAWLFNTISMAAD
LDLAPFGEAQRSVLNYGVLPLAGKRISELDCQELASRLRLAILRFEPRLLPDSVEVLHIDEPDKRLMHHN
ELVFEIRARLWSAPYPVEFRVRSELDLESGQSLLHDLAID
 
Nucleotide Sequence: 543 bp     [Download]
>gi|482897536|ref|NC_021150.1|:c2730606-2730064 Azotobacter vinelandii CA6, complete genome
ATGGCTGATCCGCTGCACACGCCCAGGGACAGGCGGCAAGCGCGCGGCAAGCGCGACCGCCTGCGCCCGG
CGCTGCTCGACCGTCTGACCGACGACGAGCCCCTGCAACGCACGGAACCCCTGACGCCGGGCGCCAGCAC
CGGCGAGTTGCGCGCCGCGGTGCTGCGCGACCTGGCCTGGCTGTTCAACACCATCAGCATGGCCGCCGAC
CTGGATCTGGCGCCGTTCGGCGAAGCGCAGCGCTCGGTGCTGAACTACGGCGTGCTGCCGCTGGCCGGCA
AGCGCATTTCCGAGCTGGACTGCCAGGAACTCGCCTCCCGGCTGCGCCTGGCCATCCTGCGCTTCGAACC
GCGCCTGCTGCCGGACAGCGTCGAGGTGCTGCACATCGACGAGCCGGACAAGCGGCTCATGCACCACAAC
GAACTGGTCTTCGAGATCCGCGCCCGGCTCTGGTCGGCGCCGTACCCGGTGGAATTCCGCGTGCGTTCCG
AACTGGATCTGGAAAGCGGCCAATCCCTGTTGCACGACCTGGCGATCGACTGA
 Primer design