SecReT6
Protein ID: 482900861
SecReT6 ID755
T6SS typei3
Gene symbol-
Locus tagAvCA6_26650
StrainAzotobacter vinelandii CA6
Repliconchromosome [GenBank: NC_021150] [Browse all T6SS(s) in this replicon]
Location [Strand]2730709..2731191 [-]
Producthypothetical protein
NoteTssD
UniProt IDM9YNP9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.70E-27, Aligned region: 2..125
Protein Sequence: 160 a.a.     [Download]
>gi|482900861|ref|YP_007898675.1| hypothetical protein AvCA6_26650 [Azotobacter vinelandii CA6]
MHLKIEGVQGESQESQHAAWLDIKSFTWGISQPGSLDSGGGGTPGRASFTDLHVVSYVEASAPTAFKKCA
NGTSLGTVELSCSRLSDGDKMVFMTITLTNVLVTKADIKGVDRDDEQERLLIEYAFQAPEVEFGYTPQQD
DGSAGGEVTMGWNIPQNTEL
 
Nucleotide Sequence: 483 bp     [Download]
>gi|482897536|ref|NC_021150.1|:c2731191-2730709 Azotobacter vinelandii CA6, complete genome
ATGCACCTGAAGATCGAGGGCGTCCAGGGCGAGTCCCAGGAGTCCCAACACGCTGCCTGGCTCGACATCA
AGTCGTTCACCTGGGGAATCAGCCAGCCCGGCTCCCTGGATTCCGGCGGCGGCGGCACCCCCGGCCGGGC
CAGCTTCACCGACCTGCACGTGGTTTCCTACGTGGAGGCCTCCGCGCCGACCGCGTTCAAGAAGTGCGCC
AACGGCACCAGCCTGGGAACGGTGGAACTGTCCTGCTCCCGGCTCTCCGACGGCGACAAGATGGTCTTCA
TGACCATCACCCTGACCAACGTGCTGGTCACCAAGGCGGACATCAAGGGCGTCGACAGGGACGACGAGCA
GGAGCGCCTGCTCATCGAGTACGCCTTCCAGGCCCCCGAGGTGGAATTCGGCTACACGCCCCAGCAGGAC
GACGGCAGCGCGGGCGGCGAGGTCACCATGGGCTGGAACATCCCCCAGAACACCGAGCTCTGA
 Primer design