SecReT6
Protein ID: 482900862
SecReT6 ID755
T6SS typei3
Gene symbol-
Locus tagAvCA6_26660
StrainAzotobacter vinelandii CA6
Repliconchromosome [GenBank: NC_021150] [Browse all T6SS(s) in this replicon]
Location [Strand]2731250..2732752 [-]
Producthypothetical protein
NoteTssC
UniProt IDM9YJT6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.60E-194, Aligned region: 67..493
Protein Sequence: 500 a.a.     [Download]
>gi|482900862|ref|YP_007898676.1| hypothetical protein AvCA6_26660 [Azotobacter vinelandii CA6]
MKQIDGALVPGAQLAEYDESEFAALLQKEFRPKTEQARSVVEDAVRTLARQALEQSVGLSGDAYNSIQSI
IAEIDRKLTEQVNLILHHADFQQLEGSWRGLHHLVNNTETDEMLKIRVLPISKKELARNLKRHKGVGWDQ
SPLFKKIYEEEYGQFGGEPYGCLIGDFHFDHSPPDVETLSELARIAAAAHCPVITAAAPSVMQMETWQEL
ANPRDLSKIFQNSEYAAWRALRESEDSRYLALTMPRFLARTPYGSRTNPVDAFDFEEDTDSTNHDRYAWA
NSAYAMGVNINRSFKLYGWCTSIRGVESGGAVENLPYHSFPTDDGGVDMKCPTEIAISDRREAELAKNGF
MPLVHRKNTNVAAFIGAQSLQKPAEYMDADATTNARLSARLPYLFACCRFAHYLKCIVRDKIGSFQERGD
IERWLNKWIMTYVDGDPLNSSQLTKARKPLAAAEVRVEEQPDNPGYYAAKFFLRPHYQLEGLTVSLRLVS
KLPSVKGSEA
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|482897536|ref|NC_021150.1|:c2732752-2731250 Azotobacter vinelandii CA6, complete genome
ATGAAACAGATCGATGGCGCCCTCGTACCGGGCGCGCAGCTTGCCGAATACGACGAAAGCGAATTCGCCG
CGCTGTTGCAGAAGGAGTTCCGGCCCAAGACGGAACAGGCGCGCAGCGTGGTGGAGGACGCCGTGCGCAC
GCTGGCCCGGCAGGCGCTGGAGCAGAGCGTCGGCCTGTCCGGCGACGCCTACAACAGCATCCAGTCCATC
ATCGCGGAAATCGACCGCAAGCTGACCGAACAGGTGAACCTGATCCTGCACCACGCCGACTTCCAGCAAC
TGGAAGGCAGTTGGCGCGGCCTGCATCACCTGGTCAACAACACCGAAACCGACGAGATGCTGAAGATCCG
CGTGCTGCCGATCTCCAAGAAGGAGCTGGCGCGCAATCTCAAGCGGCACAAAGGCGTGGGCTGGGACCAG
AGCCCGCTGTTCAAGAAGATCTACGAAGAGGAATACGGCCAGTTCGGCGGCGAGCCCTACGGCTGCCTGA
TCGGCGATTTCCATTTCGACCACAGCCCGCCGGACGTGGAAACCCTGAGCGAGCTGGCACGCATCGCCGC
CGCCGCGCACTGCCCGGTGATCACCGCGGCAGCGCCATCGGTCATGCAGATGGAAACCTGGCAGGAACTG
GCCAACCCGCGCGACCTGAGCAAGATCTTCCAGAACAGCGAATACGCCGCCTGGCGCGCCCTGCGCGAGT
CGGAGGACTCGCGCTACCTGGCGCTGACCATGCCGCGCTTCCTGGCCCGCACGCCCTACGGCAGTCGCAC
CAACCCGGTGGACGCGTTCGATTTCGAGGAAGACACCGACAGCACCAACCACGACCGCTACGCCTGGGCC
AACTCGGCCTACGCGATGGGCGTGAACATCAACCGCTCGTTCAAGCTCTACGGCTGGTGTACCTCGATCC
GCGGCGTGGAAAGCGGCGGGGCGGTGGAAAACCTGCCGTACCACAGTTTTCCCACCGACGACGGCGGGGT
GGACATGAAATGTCCCACCGAGATCGCCATCAGCGACCGCCGCGAGGCGGAACTGGCCAAGAACGGTTTC
ATGCCGCTGGTCCACCGCAAGAACACCAACGTCGCCGCTTTCATCGGCGCCCAGTCGCTGCAGAAACCCG
CCGAATACATGGATGCCGACGCCACCACCAACGCCCGGCTGTCGGCGCGCCTGCCCTATCTGTTCGCCTG
CTGCCGCTTCGCGCATTACCTCAAGTGCATCGTGCGCGACAAGATCGGTTCCTTCCAGGAGCGCGGCGAC
ATCGAGCGCTGGCTCAACAAATGGATCATGACCTATGTGGACGGCGATCCGCTCAATTCCTCGCAACTGA
CCAAGGCCAGGAAGCCCCTGGCCGCCGCCGAGGTGCGCGTCGAGGAGCAGCCGGACAACCCGGGCTACTA
CGCGGCCAAGTTCTTCCTGCGTCCCCACTACCAGCTCGAAGGGTTGACCGTGTCCCTGCGGCTGGTCTCG
AAACTGCCGTCGGTGAAGGGCAGCGAAGCCTGA
 Primer design